KEGG   Addendum: AAB18304
Entry
AAB18304          CDS       T10000                                 

Gene name
bphB
Definition
(KEGG) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC:1.3.1.56)
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Taxonomy
TAX:285
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Comamonadaceae; Comamonas
Organism
ag  Addendum (Comamonas testosteroni)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase TrkA_N HI0933_like
Other DBs
NCBI-ProteinID: AAB18304
GB: U57451
UniProt: Q46381
Structure
PDB: 
3ZV6 2Y93 2Y99

AA seq 281 aa
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDV
RSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYI
HAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVN
GVAPGGMNTDLRGPSSLGLSEQSISSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGD
SLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNINREGQE
Reference
PMID:8702262
  Authors
Sylvestre M, Hurtubise Y, Barriault D, Bergeron J, Ahmad D
  Title
Characterization of active recombinant 2,3-dihydro-2,3-dihydroxybiphenyl dehydrogenase from Comamonas testosteroni B-356 and sequence of the encoding gene (bphB).
  Journal
Appl Environ Microbiol 62:2710-5 (1996)
DOI:10.1128/AEM.62.8.2710-2715.1996

DBGET integrated database retrieval system