KEGG   Addendum: AAB29220
Entry
AAB29220          CDS       T10000                                 

Gene name
A2R
Definition
(KEGG) Orf virus vascular endothelial growth factor A homolog
  KO
K22612  Poxvirus vascular endothelial growth factor A homolog
Taxonomy
TAX:10258
  Lineage
Viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus
Organism
ag  Addendum (Orf virus)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-ProteinID: AAB29220
GB: S67520
UniProt: P52584
Structure
PDB: 
2GNN 3V6B

AA seq 133 aa
MKLLVGILVAVCLHQYLLNADSNTKGWSEVLKGSECKPRPIVVPVSETHPELTSQRFNPP
CVTLMRCGGCCNDESLECVPTEEVNVSMELLGASGSGSNGMQRLSFVEHKKCDCRPRFTT
TPPTTTRPPRRRR
Reference
PMID:8254780
  Authors
Lyttle DJ, Fraser KM, Fleming SB, Mercer AA, Robinson AJ
  Title
Homologs of vascular endothelial growth factor are encoded by the poxvirus orf virus.
  Journal
J Virol 68:84-92 (1994)
DOI:10.1128/JVI.68.1.84-92.1994

DBGET integrated database retrieval system