KEGG   Addendum: AAB39709Help
Entry
AAB39709          CDS       T10000                                 

Gene name
TDC2
Definition
(KEGG) L-tryptophan decarboxylase (EC:4.1.1.105)
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Taxonomy
TAX:16922
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; asterids; Cornales; Nyssaceae; Camptotheca
Organism
ag  Addendum (Camptotheca acuminata)
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 CybS
Motif
Other DBs
NCBI-ProteinID: AAB39709
GB: U73657
UniProt: P93083
AA seq 498 aa AA seqDB search
MGSIDSNYDTESAGQCRPLEPEEFRKQAHQMVDFIADYYKNIESYPVLSQVEPGYLQSRL
PETAPYRPEPFESILKDVHKDIIPGVTHWLSPNFFAYFPATVSSAAFVGEMLCTCFNAVG
FNWLASPAELELEMVVMDWLASMLKLPNSFTFLGTGGGVIQGTTSEAILCTLIAARDRAL
ESIGVDSIHKLVVYGSDQTHSTYAKACNLAGILPCNIRSIRTEAVANFSLSPDSLHREIE
ADVAAGMVPLYLCATVGTTSTTAIDSLSPLADVANDYGLWFHVDAAYAGSACICPEFRHY
LDGIERADSLSLSPHKWLLSYLDCCCLWVKRPSVLVKALSTDPEYLKNKPSESNSVVDFK
DWQVGTGRRFKALRLWFVMRSYGVANLQSHIRSDIQMAKMFEEFVNSDPRFEIVVPRVFS
LVCFRLNPFSKSDPCNTELLNRKLLEWVNSTGQVYITHTKVGGVYMLRFAVGATLTEEHH
VSAAWKLIREGADALLCS
Reference
PMID:9225462
  Authors
Lopez-Meyer M, Nessler CL
  Title
Tryptophan decarboxylase is encoded by two autonomously regulated genes in Camptotheca acuminata which are differentially expressed during development and stress.
  Journal
Plant J 11:1167-75 (1997)
DOI:10.1046/j.1365-313X.1997.11061167.x

DBGET integrated database retrieval system