KEGG   Addendum: AAB39767
Entry
AAB39767          CDS       T10000                                 

Gene name
tftA
Definition
(KEGG) 2,4,5-trichlorophenoxyacetic acid oxygenase 1
  KO
K15243  2,4,5-trichlorophenoxyacetic acid oxygenase 1 [EC:1.14.13.-]
Taxonomy
TAX:292
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderia cepacia complex
Organism
ag  Addendum (Burkholderia cepacia)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske LolA
Other DBs
NCBI-ProteinID: AAB39767
GB: U11420
UniProt: Q51592
AA seq 467 aa
MNTTMNTPVPSYVNDVSHRGLVDDRATDGIFRVHREAFLDPRIFELEMSRIFESTWVFIG
LESQVAKPHDFITADIGRQPVILTRNAEGKLACFLNSCRHRGALLCPFSKGNQKFHVCRY
HGWSYDSSGRNIAITDQKDGQYPSAFDKENHDLVSVARLESYRGFVFASLSPDVPTLQEH
LGGASVFLDLVADQAPNGLEYVSGTVDYTFDANWKLQFENGLDFYHFGSTHSSYVDILKL
RAQRAVAPDATQTGVKLASEPNEQGQGTFSFPRGHSVMWSTFQPGQEQRLSDGKGLQMNA
KARAGEVRWKWMMRQRNLTIFPNLQIIDLQSMQLSLQLRTWQPLAVDKTRMLSHCLAPIG
ESFDERRSRIRRYEDFFNPSGLATSDDNVMYEFCQSGYRAIAAGATQGYVRGLGKPTENQ
RDYAGELGLDNCESVYGSMAFGNETCFHAGYREWQRLLLASDTTSSV
Reference
PMID:7527626
  Authors
Danganan CE, Ye RW, Daubaras DL, Xun L, Chakrabarty AM
  Title
Nucleotide sequence and functional analysis of the genes encoding 2,4,5-trichlorophenoxyacetic acid oxygenase in Pseudomonas cepacia AC1100.
  Journal
Appl Environ Microbiol 60:4100-6 (1994)
DOI:10.1128/AEM.60.11.4100-4106.1994

DBGET integrated database retrieval system