KEGG   Addendum: AAB49835
Entry
AAB49835          CDS       T10000                                 

Gene name
btfP
Definition
(KEGG) fragilysin (EC:3.4.24.74)
  KO
K19959  fragilysin [EC:3.4.24.74]
Taxonomy
TAX:817
  Lineage
Bacteria; Bacteroidetes; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
Organism
ag  Addendum (Bacteroides fragilis)
SSDB
Motif
Pfam: fragilysinNterm Reprolysin_5 Reprolysin_4 Peptidase_M10 Reprolysin_3 Reprolysin_2 DUF2491
Other DBs
NCBI-ProteinID: AAB49835
GB: U67735
UniProt: P54355
AA seq 405 aa
MFILNFNKMKNVKLLLMLGTAALLAACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQL
NDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVL
RFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVS
VKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTI
YPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPK
AEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGH
ILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD
Reference
PMID:9011050
  Authors
Kling JJ, Wright RL, Moncrief JS, Wilkins TD
  Title
Cloning and characterization of the gene for the metalloprotease enterotoxin of Bacteroides fragilis.
  Journal
FEMS Microbiol Lett 146:279-84 (1997)
DOI:10.1111/j.1574-6968.1997.tb10205.x

DBGET integrated database retrieval system