KEGG   Addendum: AAC41455
Entry
AAC41455          CDS       T10000                                 

Definition
(KEGG) flavastacin (EC:3.4.24.76)
  KO
K20138  flavastacin [EC:3.4.24.76]
Taxonomy
TAX:238
  Lineage
Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales; Flavobacteriaceae; Elizabethkingia
Organism
ag  Addendum (Elizabethkingia meningoseptica)
SSDB
Motif
Pfam: Astacin RicinB_lectin_2 Ricin_B_lectin Peptidase_M10 DUF3810 Reprolysin_5 Peptidase_M91
Other DBs
NCBI-ProteinID: AAC41455
GB: L37784
UniProt: Q47899
AA seq 443 aa
MTRKLLILSGCLILALNSCKSDMETTPASSVDHTTTQLNGTTIHKLLINGAYTYVNEVNG
EYFYADDITITAEQFNQLKRMANPDISTVERSTIVSSFIKTWPNATVYYTLPSQGSLSTQ
AYNTFLTNINKAFDMISSKTSVKFVQRTNQTEYITFTYSTGNSSPLGWVKNRVNGIKIYN
TTYPAIIAHEIMHSMGIMHEQCRPDRDQYIIVDTNRAQDGTRHNFNLYNDYAGHGEFDFG
SVMMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNSTSATNGTYT
LTTSLAGDKNIDITGSSTADGTDVILYSATTGNNQKFIFRKSEHGYFTIKSILDSTKVLT
VRNNGTANGTAVELRTNADTDAQKWLLFNLGNEGFGFAPKNAPSLRLEVKDGLTTNLTPI
VIGSTDQTLQPYTKQRFTLTKVN
Reference
PMID:7771796
  Authors
Tarentino AL, Quinones G, Grimwood BG, Hauer CR, Plummer TH Jr
  Title
Molecular cloning and sequence analysis of flavastacin: an O-glycosylated prokaryotic zinc metalloendopeptidase.
  Journal
Arch Biochem Biophys 319:281-5 (1995)
DOI:10.1006/abbi.1995.1293

DBGET integrated database retrieval system