KEGG   Addendum: AAC43636
Entry
AAC43636          CDS       T10000                                 

Gene name
tcbB
Definition
(KEGG) cis-chlorobenzene dihydrodiol dehydrogenase
  KO
K16269  cis-1,2-dihydrobenzene-1,2-diol/chlorobenzene dihydrodiol dehydrogenase [EC:1.3.1.19 1.3.1.119]
Taxonomy
TAX:306
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp.)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR 3Beta_HSD Epimerase
Other DBs
NCBI-ProteinID: AAC43636
GB: U15298
UniProt: Q52387
AA seq 275 aa
MKLKGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEEIRKRHGDAVVGIEGDV
RSLDSHREAVARCVETFGKLDCLIGNAGVWDYLTQLADIPDNGISEAFDEMFAINVKGYI
LAAKAALPALYKSKGSAIFTVSNAGFYPGGGGVLYTAGKHAVIGLVKQLAHEWGPRIRVN
GIAPGGILGSDLRGLKTLGLQDQTIATMPLADMLGPVLPTGRMATAEEYAGAYVFFATRA
DTVPLTGSVLNIDGGMGVRGLFEASLGAQLDKHFA
Reference
PMID:8626733
  Authors
Werlen C, Kohler HP, van der Meer JR
  Title
The broad substrate chlorobenzene dioxygenase and cis-chlorobenzene dihydrodiol dehydrogenase of Pseudomonas sp. strain P51 are linked evolutionarily to the enzymes for benzene and toluene degradation.
  Journal
J Biol Chem 271:4009-16 (1996)
DOI:10.1074/jbc.271.8.4009
Reference
PMID:1987135
  Authors
van der Meer JR, van Neerven AR, de Vries EJ, de Vos WM, Zehnder AJ.
  Title
Cloning and characterization of plasmid-encoded genes for the degradation of 1,2-dichloro-, 1,4-dichloro-, and 1,2,4-trichlorobenzene of Pseudomonas sp. strain P51.
  Journal
J Bacteriol 173:6-15 (1991)
DOI:10.1128/jb.173.1.6-15.1991

DBGET integrated database retrieval system