KEGG   Addendum: AAC44655Help
Entry
AAC44655          CDS       T10000                                 

Gene name
chcA
Definition
(KEGG) cyclohexane-1-carbonyl-CoA reductase (NADP+) (EC:1.3.1.120)
  KO
K23738  cyclohexane-1-carbonyl-CoA reductase (NADP+) [EC:1.3.1.120]
Taxonomy
TAX:42684
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces collinus)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AAC44655
GB: U72144
UniProt: P95727
AA seq 280 aa AA seqDB search
MNSPHQQQTADRRQVSLITGASRGIGRTLALTLARRGGTVVVNYKKNADLAQKTVAEVEE
AGGQGFAVQADVETTEGVTALFDEVAQRCGRLDHFVSNAAASAFKNIVDLGPHHLDRSYA
MNLRPFVLGAQQAVKLMDNGGRIVALSSYGSVRAYPTYAMLGGMKAAIESWVRYMAVEFA
PYGINVNAVNGGLIDSDSLEFFYNVEGMPPMQGVLDRIPARRPGTVQEMADTIAFLLGDG
AGYITGQTLVVDGGLSIVAPPFFADAGEALELPPRPTRDA
Reference
PMID:8955309
  Authors
Wang P, Denoya CD, Morgenstern MR, Skinner DD, Wallace KK, Digate R, Patton S, Banavali N, Schuler G, Speedie MK, Reynolds KA
  Title
Cloning and characterization of the gene encoding 1-cyclohexenylcarbonyl coenzyme A reductase from Streptomyces collinus.
  Journal
J Bacteriol 178:6873-81 (1996)
DOI:10.1128/jb.178.23.6873-6881.1996
Reference
  Authors
Cropp TA, Wilson DJ, Reynolds KA
  Title
Identification of a cyclohexylcarbonyl CoA biosynthetic gene cluster and application in the production of doramectin.
  Journal
Nat Biotechnol 18:980-3 (2000)
DOI:10.1038/79479

DBGET integrated database retrieval system