KEGG   Addendum: AAC44807Help
Entry
AAC44807          CDS       T10000                                 

Gene name
tsaC1
Definition
(KEGG) 4-formylbenzenesulfonate dehydrogenase (EC:1.2.1.62)
  KO
K19630  4-formylbenzenesulfonate dehydrogenase [EC:1.2.1.62]
Taxonomy
TAX:285
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Comamonadaceae; Comamonas
Organism
ag  Addendum (Comamonas testosteroni)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase F420_oxidored YjeF_N GIDA
Motif
Other DBs
NCBI-ProteinID: AAC44807
GB: AF311437
UniProt: P94681
AA seq 252 aa AA seqDB search
MNLNKQVAIVTGGASGFGAAIARRLSQAGAAVLVADLNAEGAQRMATELNAAGGRALGMA
CDVSKEADYRAVVDAAIAQLGGLHIVVNNAGTTHRNKPALAVTEDEFDRVYRVNLKSVYW
SAQCALPHFAQQGHGVMVNVASTTGVRPGPGLTWYSGSKAAMINLTKGLALEFARSGVRI
NAVNPMIGETPMMADFMGMEDTPANRERFLSRIPLGRFTRPDDVASAVAFLASDDASFLT
GVCLDVDGGRNI
Reference
PMID:8828208
  Authors
Junker F, Saller E, Schlafli Oppenberg HR, Kroneck PM, Leisinger T, Cook AM
  Title
Degradative pathways for p-toluenecarboxylate and p-toluenesulfonate and their multicomponent oxygenases in Comamonas testosteroni strains PSB-4 and T-2.
  Journal
Microbiology 142 ( Pt 9):2419-27 (1996)
DOI:10.1099/00221287-142-9-2419

DBGET integrated database retrieval system