KEGG   Addendum: AAC69330Help
Entry
AAC69330          CDS       T10000                                 

Gene name
pikAII
Definition
(KEGG) 10-deoxymethynolide/narbonolide synthase
  KO
K16001  narbonolide/10-deoxymethynolide synthase [EC:2.3.1.240 2.3.1.239]
Taxonomy
TAX:54571
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces venezuelae)
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH PP-binding KAsynt_C_assoc Thiolase_N adh_short ADH_zinc_N_2 ADH_zinc_N Docking ADH_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAC69330
GB: AF079138
UniProt: Q9ZGI4
Structure
PDB: 

AA seq 3739 aa AA seqDB search
MSTVNEEKYLDYLRRATADLHEARGRLRELEAKAGEPVAIVGMACRLPGGVASPEDLWRL
VAGGEDAISEFPQDRGWDVEGLYDPNPEATGKSYAREAGFLYEAGEFDADFFGISPREAL
AMDPQQRLLLEASWEAFEHAGIPAATARGTSVGVFTGVMYHDYATRLTDVPEGIEGYLGT
GNSGSVASGRVAYTLGLEGPAVTVDTACSSSLVALHLAVQALRKGEVDMALAGGVTVMST
PSTFVEFSRQRGLAPDGRSKSFSSTADGTSWSEGVGVLLVERLSDARRKGHRILAVVRGT
AVNQDGASSGLTAPNGPSQQRVIRRALADARLTTSDVDVVEAHGTGTRLGDPIEAQAVIA
TYGQGRDGEQPLRLGSLKSNIGHTQAAAGVSGVIKMVQAMRHGVLPKTLHVEKPTDQVDW
SAGAVELLTEAMDWPDKGDGGLRRAAVSSFGVSGTNAHVVLEEAPAAEETPASEATPAVE
PSVGAGLVPWLVSAKTPAALDAQIGRLAAFASQGRTDAADPGAVARVLAGGRAEFEHRAV
VLGTGQDDFAQALTAPEGLIRGTPSDVGRVAFVFPGQGTQWAGMGAELLDVSKEFAAAMA
ECESALSRYVDWSLEAVVRQAPGAPTLERVDVVQPVTFAVMVSLAKVWQHHGVTPQAVVG
HSQGEIAAAYVAGALTLDDAARVVTLRSKSIAAHLAGKGGMISLALSEEATRQRIENLHG
LSIAAVNGPTATVVSGDPTQIQELAQACEADGVRARIIPVDYASHSAHVETIESELAEVL
AGLSPRTPEVPFFSTLEGAWITEPVLDGTYWYRNLRHRVGFAPAVETLATDEGFTHFIEV
SAHPVLTMTLPETVTGLGTLRREQGGQERLVTSLAEAWTNGLTIDWAPVLPTATGHHPEL
PTYAFQRRHYWLHDSPAVQGSVQDSWRYRIDWKRLAVADASERAGLSGRWLVVVPEDRSA
EAAPVLAALSGAGADPVQLDVSPLGDRQRLAATLGEALAAAGGAVDGVLSLLAWDESAHP
GHPAPFTRGTGATLTLVQALEDAGVAAPLWCVTHGAVSVGRADHVTSPAQAMVWGMGRVA
ALEHPERWGGLIDLPSDADRAALDRMTTVLAGGTGEDQVAVRASGLLARRLVRASLPAHG
TASPWWQADGTVLVTGAEEPAAAEAARRLARDGAGHLLLHTTPSGSEGAEGTSGAAEDSG
LAGLVAELADLGATATVVTCDLTDAEAAARLLAGVSDAHPLSAVLHLPPTVDSEPLAATD
ADALARVVTAKATAALHLDRLLREAAAAGGRPPVLVLFSSVAAIWGGAGQGAYAAGTAFL
DALAGQHRADGPTVTSVAWSPWEGSRVTEGATGERLRRLGLRPLAPATALTALDTALGHG
DTAVTIADVDWSSFAPGFTTARPGTLLADLPEARRALDEQQSTTAADDTVLSRELGALTG
AEQQRRMQELVREHLAVVLNHPSPEAVDTGRAFRDLGFDSLTAVELRNRLKNATGLALPA
TLVFDYPTPRTLAEFLLAEILGEQAGAGEQLPVDGGVDDEPVAIVGMACRLPGGVASPED
LWRLVAGGEDAISGFPQDRGWDVEGLYDPDPDASGRTYCRAGGFLDEAGEFDADFFGISP
REALAMDPQQRLLLETSWEAVEDAGIDPTSLQGQQVGVFAGTNGPHYEPLLRNTAEDLEG
YVGTGNAASIMSGRVSYTLGLEGPAVTVDTACSSSLVALHLAVQALRKGECGLALAGGVT
VMSTPTTFVEFSRQRGLAEDGRSKAFAASADGFGPAEGVGMLLVERLSDARRNGHRVLAV
VRGSAVNQDGASNGLTAPNGPSQQRVIRRALADARLTTADVDVVEAHGTGTRLGDPIEAQ
ALIATYGQGRDTEQPLRLGSLKSNIGHTQAAAGVSGIIKMVQAMRHGVLPKTLHVDRPSD
QIDWSAGTVELLTEAMDWPRKQEGGLRRAAVSSFGISGTNAHIVLEEAPVDEDAPADEPS
VGGVVPWLVSAKTPAALDAQIGRLAAFASQGRTDAADPGAVARVLAGGRAQFEHRAVALG
TGQDDLAAALAAPEGLVRGVASGVGRVAFVFPGQGTQWAGMGAELLDVSKEFAAAMAECE
AALAPYVDWSLEAVVRQAPGAPTLERVDVVQPVTFAVMVSLAKVWQHHGVTPQAVVGHSQ
GEIAAAYVAGALSLDDAARVVTLRSKSIGAHLAGQGGMLSLALSEAAVVERLAGFDGLSV
AAVNGPTATVVSGDPTQIQELAQACEADGVRARIIPVDYASHSAHVETIESELADVLAGL
SPQTPQVPFFSTLEGAWITEPALDGGYWYRNLRHRVGFAPAVETLATDEGFTHFVEVSAH
PVLTMALPETVTGLGTLRRDNGGQHRLTTSLAEAWANGLTVDWASLLPTTTTHPDLPTYA
FQTERYWPQPDLSAAGDITSAGLGAAEHPLLGAAVALADSDGCLLTGSLSLRTHPWLADH
AVAGTVLLPGTAFVELAFRAGDQVGCDLVEELTLDAPLVLPRRGAVRVQLSVGASDESGR
RTFGLYAHPEDAPGEAEWTRHATGVLAARADRTAPVADPEAWPPPGAEPVDVDGLYERFA
ANGYGYGPLFQGVRGVWRRGDEVFADVALPAEVAGAEGARFGLHPALLDAAVQAAGAGRG
VRRGHAAAVRLERDLLYAVGATALRVRLAPAGPDTVSVSAADSSGQPVFAADSLTVLPVD
PAQLAAFSDPTLDALHLLEWTAWDGAAQALPGAVVLGGDADGLAAALRAGGTEVLSFPDL
TDLVEAVDRGETPAPATVLVACPAAGPDGPEHVREALHGSLALMQAWLADERFTDGRLVL
VTRDAVAARSGDGLRSTGQAAVWGLGRSAQTESPGRFVLLDLAGEARTAGDATAGDGLTT
GDATVGGTSGDAALGSALATALGSGEPQLALRDGALLVPRLARAAAPAAADGLAAADGLA
ALPLPAAPALWRLEPGTDGSLESLTAAPGDAETLAPEPLGPGQVRIAIRATGLNFRDVLI
ALGMYPDPALMGTEGAGVVTATGPGVTHLAPGDRVMGLLSGAYAPVVVADARTVARMPEG
WTFAQGASVPVVFLTAVYALRDLADVKPGERLLVHSAAGGVGMAAVQLARHWGVEVHGTA
SHGKWDALRALGLDDAHIASSRTLDFESAFRAASGGAGMDVVLNSLAREFVDASLRLLGP
GGRFVEMGKTDVRDAERVAADHPGVGYRAFDLGEAGPERIGEMLAEVIALFEDGVLRHLP
VTTWDVRRARDAFRHVSQARHTGKVVLTMPSGLDPEGTVLLTGGTGALGGIVARHVVGEW
GVRRLLLVSRRGTDAPGAGELVHELEALGADVSVAACDVADREALTAVLDSIPAEHPLTA
VVHTAGVLSDGTLPSMTAEDVEHVLRPKVDAAFLLDELTSTPGYDLAAFVMFSSAAAVFG
GAGQGAYAAANATLDALAWRRRTAGLPALSLGWGLWAETSGMTGGLSDTDRSRLARSGAT
PMDSELTLSLLDAAMRRDDPALVPIALDVAALRAQQRDGMLAPLLSGLTRGSRVGGAPVN
QRRAAAGGAGEADTDLGGRLAAMTPDDRVAHLRDLVRTHVATVLGHGTPSRVDLERAFRD
TGFDSLTAVELRNRLNAATGLRLPATLVFDHPTPGELAGHLLDELATAAGGSWAEGTGSG
DTASATDRQTTAALAELDRLEGVLASLAPAAGGRPELAARLRALAAALGDDGDDATDLDE
ASDDDLFSFIDKELGDSDF
Reference
PMID:9770448
  Authors
Xue Y, Zhao L, Liu HW, Sherman DH
  Title
A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity.
  Journal
Proc Natl Acad Sci U S A 95:12111-6 (1998)
DOI:10.1073/pnas.95.21.12111

DBGET integrated database retrieval system