KEGG   Addendum: AAD15267
Entry
AAD15267          CDS       T10000                                 

Gene name
dnrS
Definition
(KEGG) glycosyltransferase
  KO
K15951  glycosyltransferase [EC:2.4.1.-]
Taxonomy
TAX:1950
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces peucetius)
SSDB
Motif
Pfam: DUF1205 B12-binding
Other DBs
NCBI-ProteinID: AAD15267
GB: L47164
UniProt: Q54824
AA seq 431 aa
MKVLVTAFAMDAHFNGVVPLAWALRAAGHDVRVASQPALTDSITRAGLTAVPVGTDHQVQ
AAMGAMAPGVFALHLNPDYLENRPELLDLEFLEASTSMLTAAFYAQINNDSMIDEMVDFA
AWWRPDLVVWEPFTFGGAVAAQVTGAAQARLLWGPDLFLRVHDRFQQVLHEVPAERRDDA
LEEWLTWTLERHGAAFGPEVISGHWTIDQMPPSVRFATARPTVPMRFVPYNGPVPAVVPP
WLRADPGRPRVLLTQGITERSTGFTGLPRAGELLASIAELDAEVVATVKAEEREGLPPLP
GNVRVVDSLSLHVVLPSCAAVVHHGGAGTWATAALHGVPQLALAWQWDDVFRAGQLEKLG
AGIFLPPHGEGASAGRVRDRLAQVLAEPSFRQGAARIRAEMLRTPAPGAVVPTLEQLTAR
HRAPAGQGVRH
Reference
PMID:7592454
  Authors
Otten SL, Liu X, Ferguson J, Hutchinson CR
  Title
Cloning and characterization of the Streptomyces peucetius dnrQS genes encoding a daunosamine biosynthesis enzyme and a glycosyl transferase involved in daunorubicin biosynthesis.
  Journal
J Bacteriol 177:6688-92 (1995)
DOI:10.1128/JB.177.22.6688-6692.1995

DBGET integrated database retrieval system