KEGG   Addendum: AAD45417Help
Entry
AAD45417          CDS       T10000                                 

Gene name
nsaE
Definition
(KEGG) trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (EC:4.1.2.45)
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Taxonomy
TAX:121428
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingobium
Organism
ag  Addendum (Sphingobium xenophagum)
SSDB OrthologParalogGFIT
Motif
Pfam: DHDPS CutC
Motif
Other DBs
NCBI-ProteinID: AAD45417
GB: U65001
UniProt: Q9X9Q6
AA seq 328 aa AA seqDB search
MARTLMKPDDVKGAWAIIPTPAKDDASDWRATKTVDLDETARVVNGLIDAGINGILSMGT
LGEAATMTHDEKLDFIKALVDAAAGRVPIFVGTTCLNTRDTIALTRQALDIGADGTMLGV
PMWCAPSVDVAVQFYKDLAEAVPEMNIAIYANPEAFKFDFPRSFWAQVAEIPQVVTAKYI
GVAHLLPDLAAIRGRIKLLPIDFDYYGAARMDESIDAFWSSGAVCDPLVTTTLRDLVSQA
RATGDWSAARAFMGRLGPTAAPLFPNGSFKEFSTYNIALEKARMNAGGWMNAGPVRPPYH
LCPEPYLEGARLSGRMWAELGKALAAEK
Reference
  Authors
Keck A, Conradt D, Mahler A, Stolz A, Mattes R, Klein J
  Title
Identification and functional analysis of the genes for naphthalenesulfonate catabolism by Sphingomonas xenophaga BN6.
  Journal
Microbiology 152:1929-40 (2006)
DOI:10.1099/mic.0.28783-0

DBGET integrated database retrieval system