KEGG   Addendum: AAF00209
Entry
AAF00209          CDS       T10000                                 

Gene name
urdGT2
Definition
(KEGG) glycosyltransferase
  KO
K15936  glycosyltransferase [EC:2.4.1.-]
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
SSDB
Motif
Pfam: DUF1205 Glyco_transf_4
Other DBs
NCBI-ProteinID: AAF00209
GB: AF164960
UniProt: Q9RPA7
Structure
PDB: 
2P6P

AA seq 365 aa
MFALAPLATAARNAGHQVVMAANQDMGPVVTGVGLPAVATTDLPIRHFITTDREGRPEAI
PSDPVAQARFTGRWFARMAASSLPRMLDFSRAWRPDLIVGGTMSYVAPLLALHLGVPHAR
QTWDAVDADGIHPGADAELRPELSELGLERLPAPDLFIDICPPSLRPANAAPARMMRHVA
TSRQCPLEPWMYTRDTRQRVLVTSGSRVAKESYDRNFDFLRGLAKDLVRWDVELIVAAPD
TVAEALRAEVPQARVGWTPLDVVAPTCDLLVHHAGGVSTLTGLSAGEPQLLIPKGSVLEA
PARRVADYGAAIALLPGEDSTEAIADSCQELHAKDTYARRAQDLSREISGMPLPATVVTA
LEQLA
Reference
  Authors
Faust B, Hoffmeister D, Weitnauer G, Westrich L, Haag S, Schneider P, Decker H, Kunzel E, Rohr J, Bechthold A
  Title
Two new tailoring enzymes, a glycosyltransferase and an oxygenase, involved in biosynthesis of the angucycline antibiotic urdamycin A in Streptomyces fradiae Tu2717.
  Journal
Microbiology 146 ( Pt 1):147-54 (2000)
DOI:10.1099/00221287-146-1-147

DBGET integrated database retrieval system