KEGG   Addendum: AAF01808
Entry
AAF01808          CDS       T10000                                 

Gene name
snoaL2
Definition
(KEGG) C-1 hydroxylase
  KO
K15945  C-1 hydroxylase
Taxonomy
TAX:38314
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces nogalater)
SSDB
Motif
Pfam: SnoaL SnoaL_2 DUF4440
Other DBs
NCBI-ProteinID: AAF01808
GB: AF187532
UniProt: Q9RN64
Structure
PDB: 
2GEX

AA seq 139 aa
MSTTANKERCLEMVAAWNRWDVSGVVAHWAPDVVHYDDEDKPVSAEEVVRRMNSAVEAFP
DLRLDVRSIVGEGDRVMLRITCSATHQGVFMGIAPTGRKVRWTYLEELRFSEAGKVVEHW
DVFNFSPLFRDLGVVPDGL
Reference
  Authors
Torkkell S, Kunnari T, Palmu K, Mantsala P, Hakala J, Ylihonko K
  Title
The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures.
  Journal
Mol Genet Genomics 266:276-88 (2001)
DOI:10.1007/s004380100554

DBGET integrated database retrieval system