KEGG   Addendum: AAF14228
Entry
AAF14228          CDS       T10000                                 

Gene name
absAb
Definition
(KEGG) 2-aminobenzenesulfonate 2,3-dioxygenase subunit beta (EC:1.14.12.14)
  KO
K15767  2-aminobenzenesulfonate 2,3-dioxygenase subunit beta [EC:1.14.12.14]
Taxonomy
TAX:108557
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Alcaligenaceae; Alcaligenes
Organism
ag  Addendum (Alcaligenes sp. O-1)
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: AAF14228
GB: AF109074
UniProt: Q9RBG4
AA seq 150 aa
MDTVSIAEFLYTNADLLNQEQFDSWLEQCSNDFSYRITTFSEELGRPMDWMDKDKSGLAH
YLQNANNHERYTGRLRRHLAMPRVTKQADSSFEVRTAVAIYVIEMNGETALYGIGSYVDN
VMSESSGLRLTSRVVTLDTRRLQFGPHVPI
Reference
  Authors
Mampel J, Ruff J, Junker F, Cook AM.
  Title
The oxygenase component of the 2-aminobenzenesulfonate dioxygenase system from Alcaligenes sp. strain O-1.
  Journal
Microbiology 145 ( Pt 11):3255-64 (1999)
DOI:10.1099/00221287-145-11-3255

DBGET integrated database retrieval system