KEGG   Addendum: AAF66543Help
Entry
AAF66543          CDS       T10000                                 

Gene name
CYP79E1
Definition
(KEGG) tyrosine N-monooxygenase
  KO
K20785  tyrosine N-monooxygenase [EC:1.14.14.36]
Taxonomy
TAX:55501
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Juncaginaceae; Triglochin
Organism
ag  Addendum (Triglochin maritima)
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AAF66543
GB: AF140609
UniProt: Q9M7C0
AA seq 540 aa AA seqDB search
MELITILPSVLPNIHSTATVLFLLLLTTALSFLFLFKQHLTKLTKSKSKSTTLPPGPRPW
PIVGSLVSMYMNRPSFRWILAQMEGRRIGCIRLGGVHVVPVNCPEIAREFLKVHDADFAS
RPVTVVTRYSSRGFRSIAVVPLGEQWKKMRRVVASEIINAKRLQWQLGLRTEEADNIMRY
ITYQCNTSGDTNGAIIDVRFALRHYCANVIRRMLFGKRYFGSGGEGGGPGKEEIEHVDAT
FDVLGLIYAFNAADYVSWLKFLDLHGQEKKVKKAIDVVNKYHDSVIESRRERKVEGREDK
DPEDLLDVLLSLKDSNGKPLLDVEEIKAQIADLTYATVDNPSNAVEWALAEMLNNPDILQ
KATDEVDQVVGRHRLVQESDFPNLPYIRACAREALRLHPVAAFNLPHVSLRDTHVAGFFI
PKGSHVLLSRVGLGRNPKVWDNPLRFDPDRHLHGGPTAKVELAEPELRFVSFTTGRRGCM
GGPLGTAMTYMLLARFVQGFTWGLRPAVEKVELEEEKCSMFLGKPLRALAKPRQELLQSF
Reference
  Authors
Nielsen JS, Moller BL
  Title
Cloning and expression of cytochrome P450 enzymes catalyzing the conversion of tyrosine to p-hydroxyphenylacetaldoxime in the biosynthesis of cyanogenic glucosides in Triglochin maritima.
  Journal
Plant Physiol 122:1311-21 (2000)
DOI:10.1104/pp.122.4.1311

DBGET integrated database retrieval system