KEGG   Addendum: AAK15506Help
Entry
AAK15506          CDS       T10000                                 

Gene name
boh
Definition
(KEGG) 1-butanol dehydrogenase (quinone) (EC:1.1.5.11)
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Taxonomy
TAX:86174
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Rhodocyclales; Zoogloeaceae; Thauera
Organism
ag  Addendum (Thauera butanivorans)
SSDB OrthologParalogGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3
Motif
Other DBs
NCBI-ProteinID: AAK15506
GB: AF326086
UniProt: Q9AGW3
AA seq 623 aa AA seqDB search
MKKSHAKPFALRAIVVATAAALSLPAAAVTDVTWEDIANDHKTTGDVLTYGLGLKAQRHS
PLKAINTDNVANLVPAWSFSFGGEKQRGQEAQVLVHDGVIYATASYSRIFAIDARSGKRL
WEYNARLPDDIRPCCDVVNRGAAIYGDKVFFGTLDAAMVALDRKTGKVVWRKKFGDHKVG
YTMTGAPFVIKDQKSGRTLLVHGSSGDEFGVVGWLFARDPDTGEEVWARPMVEGHMGRLN
GKDSTPTGDPKAPSWPDDPNSPTGKVEAWSQGGGAPWQTASFDVENNMVVIGAGNPAPWN
TWKRTAPGDDPRNWDSLFTSGQAYVDASTGELKGFYQHTPNDAWDFSGNNSVVLFEYKDP
KTGKMVNASAHADRNGFFFVTDRDMLAKGAGYPNKPTSLIGAWPFVDGITWASGFDLKTG
KPIEKDNRPPQPKEGADKGESIFVSPPFLGGTNWHPMSYSPDTGLFYIPANHWAMDYWTE
NVTYKAGSAYLGQGFRIKNLFDDHVGILRAIDPSPARSLGAQGRVPAVAGTLTTAGGWVF
TGTSDGYLKAFDAKNGKELWKFQTGSGVVSVPVTWEMDGEQYVAIQSGYGGAVPLWGGDM
AELTKQVTQGGSMWVFKLPKASR
Reference
  Authors
Vangnai AS, Arp DJ, Sayavedra-Soto LA
  Title
Two distinct alcohol dehydrogenases participate in butane metabolism by Pseudomonas butanovora.
  Journal
J Bacteriol 184:1916-24 (2002)
DOI:10.1128/JB.184.7.1916-1924.2002

DBGET integrated database retrieval system