KEGG   Addendum: AAL93619
Entry
AAL93619          CDS       T10000                                 

Gene name
GLU
Definition
(KEGG) oleuropein beta-glucosidase (EC:3.2.1.206)
  KO
K22425  oleuropein beta-glucosidase [EC:3.2.1.206]
Taxonomy
TAX:4146
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Oleaceae; Oleeae; Olea
Organism
ag  Addendum (Olea europaea)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-ProteinID: AAL93619
GB: AY083162
UniProt: Q8GVD0
AA seq 551 aa
MDIQSNVLTITSGSTPTDTSSNGQAAKSTKERIKRSDFPSDFVFGAATASYQVEGAWNEG
GKGMSNWDYFTQSQPGGISDFSNGTIAIDHYNMFKDDVVVMKKLGLKAYRFSLSWPRILP
GGRLCHGVSKEGVQFYNDLIDALLAADIEPYITIFHWDIPQCLQLEYGGFLHERVVKDFI
EYSEICFWEFGDRVKYWITLNEPWSFTVQGYVAGAFPPNRGVTPKDTEETQKHARLHRGG
GKLLAAFKYGNPGTEPYKVAHNLILCHAHAVDIYRTKYQESQGGKIGITNCISWNEPLTD
SQEDKDAATRGNDFMLGWFVEPVVTGEYPESMIKYVGDRLPKFSEKEEKLVKGSYDFLGI
NYYTSTYTSDDPTKPTTDSYFTDSHTKTSHERNKVPIGAQAGSDWLYIVPWGIYRVMVDM
KKRYNDPVIYITENGVDEVNDKSKTSTEALKDDIRIHYHQEHLYYLKLAMDQGVNVKGYF
IWSLFDNFEWAAGFSVRFGVMYVDYANGRYTRLPKRSAVWWRNFLTKPTAVPLKNEPEKS
EDRRKRLRGST
Comment
Unpublished sequence data: Gazis F, Hatzopoulos P (2002).
Reference
  Authors
Koudounas K, Thomopoulou M, Michaelidis C, Zevgiti E, Papakostas G, Tserou P, Daras G, Hatzopoulos P
  Title
The C-Domain of Oleuropein beta-Glucosidase Assists in Protein Folding and Sequesters the Enzyme in Nucleus.
  Journal
Plant Physiol 174:1371-1383 (2017)
DOI:10.1104/pp.17.00512

DBGET integrated database retrieval system