KEGG   Addendum: AAM27198
Entry
AAM27198          CDS       T10000                                 

Definition
(KEGG) physarolisin (EC:3.4.21.103)
  KO
K20756  physarolisin [EC:3.4.21.103]
Taxonomy
TAX:5791
  Lineage
Eukaryota; Amoebozoa; Evosea; Eumycetozoa; Myxogastria; Myxogastromycetidae; Physariida; Physaraceae; Physarum
Organism
ag  Addendum (Physarum polycephalum)
SSDB
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Other DBs
NCBI-ProteinID: AAM27198
GB: AF502290
UniProt: Q8MZS4
AA seq 575 aa
MRLLSLLFLLGLATLSFAVRSQWAQQGRATHEALITIRFALTQQNLDVLERTLLDISDTT
SKNYGKWKTAEEVTELVAPAREISERVASFLERQGATKVENFRDMVKVTAPVSWIEETLH
TNLFFFQHKTRTSKVIIRADGGYKIPAEIAEHVDFVAGLFEFPSIKNARTQVGAGVDGYI
VPYVIFDLYGIPTTFPVHPNSSICLVEFQDDQSYNKDDLKKFAKENEITETVVSHTVGPY
SGSSADTESTLDVQYGGAIALNTTVWFWTVEDWMYDFATDFLNTKNPPLVVSMSWGWPEP
EQCQVGNCTGDETSLEYVVRTNVEFQKIGAIGTTLLAASGDQGAPGDSDPECNSKKKPLS
SIFPGASPWVLSVGATMLSNMTTEDADPSAEPPICKSWTCSTSTTELVCTIPQALITTGG
GFSDYSLQPSYQNAAVAAYFKSGVPLPPQTDFNASNRGFPDVSALGHNYLIALSGDFEQV
DGTSASTPVFAAIIAHLNSYRLNNGKPPLAFAVPLIYQAFASDPTIFNDITTGDNKCTED
CCSKFGYEATKGWDPVTGVGTPVFSKLLAFVQTLP
Reference
  Authors
Nishii W, Ueki T, Miyashita R, Kojima M, Kim YT, Sasaki N, Murakami-Murofushi K, Takahashi K
  Title
Structural and enzymatic characterization of physarolisin (formerly physaropepsin) proves that it is a unique serine-carboxyl proteinase.
  Journal
Biochem Biophys Res Commun 301:1023-9 (2003)
DOI:10.1016/S0006-291X(03)00083-4

DBGET integrated database retrieval system