KEGG   Addendum: AAM70343
Entry
AAM70343          CDS       T10000                                 

Gene name
calO1
Definition
(KEGG) orsellinic acid C3-O-methyltransferase
  KO
K21258  orsellinic acid C3-O-methyltransferase [EC:2.1.1.-]
Taxonomy
TAX:1877
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora echinospora)
SSDB
Motif
Pfam: Methyltransf_2 Methyltransf_25 Dimerisation2 Methyltransf_12 MarR_2 Methyltransf_11 Methyltransf_19 HTH_15 HTH_45 Methyltransf_31
Other DBs
NCBI-ProteinID: AAM70343
GB: AF497482
UniProt: Q8KNE5
Structure
PDB: 
3LST

AA seq 345 aa
MQRQRPPSRAGGDMDRLQSALALYEEAMGYTYAAALRAAAAVGVADHLVDGPRTPAELAA
ATGTDADALRRVLRLLAVRDVVRESDGRFALTDKGAALRSDSPVPARAGILMFTDTMFWT
MSHRVASALGPERPAFADIFGSSLDAYFDGDAEVEALYYEGMETVSAAEHLILARAGDFP
ATGTVADVGGGRGGFLLTVLREHPGLQGVLLDRAEVVARHRLDAPDVAGRWKVVEGDFLR
EVPHADVHVLKRILHNWGDEDSVRILTNCRRVMPAHGRVLVIDAVVPEGNDAHQSKEMDF
MMLAARTGQERTAAELEPLFTAAGLRLDRVVGTSSVMSIAVGVPA
Reference
  Authors
Ahlert J, Shepard E, Lomovskaya N, Zazopoulos E, Staffa A, Bachmann BO, Huang K, Fonstein L, Czisny A, Whitwam RE, Farnet CM, Thorson JS
  Title
The calicheamicin gene cluster and its iterative type I enediyne PKS.
  Journal
Science 297:1173-6 (2002)
DOI:10.1126/science.1072105

DBGET integrated database retrieval system