KEGG   Addendum: AAQ75553
Entry
AAQ75553          CDS       T10000                                 

Definition
(KEGG) taxoid 7beta-hydroxylase (EC:1.14.13.147)
  KO
K21720  taxoid 7beta-hydroxylase [EC:1.14.13.147]
Taxonomy
TAX:99806
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Cupressales; Taxaceae; Taxus
Organism
ag  Addendum (Taxus cuspidata)
SSDB
Motif
Pfam: p450 DUF2834
Other DBs
NCBI-ProteinID: AAQ75553
GB: AY307951
UniProt: Q6JTJ0
AA seq 500 aa
MDALSLVNSTVAKFNEVTQLQASPAILSTALTAIAGIIVLLVITSKRRSSLKLPPGKLGL
PFIGETLEFVKALRSDTLRQFVEEREGKFGRVFKTSLLGKPTVILCGPAGNRLVLSNEEK
LLHVSWSAQIARILGLNSVAVKRGDDHRVLRVALAGFLGSAGLQLYIGKMSALIRNHINE
KWKGKDEVNVLSLVRDLVMDNSAILFFNIYDKERKQQLHEILKIILASHFGIPLNIPGFL
YRKALKGSLKRKKILSALLEKRKDELRSRLASSNQDLLSVLLSFRDERGKPLSDEAVLDN
CFAMLDASYDTTTSQMTLILKMLSSNPECFEKVVQEQLEIASNKKEGEEITMKDIKAMKY
TWQVLQESLRMLSPVFGTLRKTMNDINHDGYTIPKGWQVVWTTYSTHQKDIYFKQPDKFM
PSRFEEEDGHLDAYTFVPFGGGRRTCPGWEYAKVEILLFLHHFVKAFSGYTPTDPHERIC
GYPVPLVPVKGFPIKLIARS
Reference
  Authors
Chau M, Jennewein S, Walker K, Croteau R
  Title
Taxol biosynthesis: Molecular cloning and characterization of a cytochrome P450 taxoid 7 beta-hydroxylase.
  Journal
Chem Biol 11:663-72 (2004)
DOI:10.1016/j.chembiol.2004.02.025

DBGET integrated database retrieval system