KEGG   Addendum: AAY41422
Entry
AAY41422          CDS       T10000                                 

Gene name
CS
Definition
(KEGG) alpha-copaene synthase (EC:4.2.3.133)
  KO
K22065  alpha-copaene/(+)-delta-cadinene synthase [EC:4.2.3.133 4.2.3.13]
Taxonomy
TAX:4232
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Organism
ag  Addendum (Helianthus annuus)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: AAY41422
GB: DQ016668
UniProt: Q4U3F6
AA seq 555 aa
MATTEANTMAQANSQTTIEPVRHLANFPPSIWGDQFLSFSLDNSQLEAYSKAMEQPKENV
RRMILNPAIDTNEKLGLIYCVYRLGLTYNFSKDIDGQLDELFKQLNLQSYNEADLYTISI
HFQVFRHFGYRFSCDVFNKFKDSSSGKFKEDMTRDVRGMISLYESAQLRIRGESILDEAG
AFAESKLKTIEKTLDGTLAQQVKHVLERPFNRGHQMVEARKYLFLFEEEISRYDSLLMLA
KVHFNYLQLLQKEELRSVSKWWKDLDLPAKTLYVRDRVPELYVWILAFFLEPYYSEVRII
TTKIVLLVLVLDDTYDAYATIEESRLLTHAINRWEVSAMLQLPEYMKPLYEILLNEYDGF
YKHGRTNVIETSKKAFQDLARSYHQESEWRHAKEVPSFEEYMKIGTTTSAHNVLSKTALI
GMGNIVTREALAWYESYPKIVQLSELIGRLEDDVVSVEFERERAPTATSVDAYMKTYGVS
ENVAVKILKKLVENGWKDLNEACLKPTEVSLDLLAPIIGLTNMTDVAYRHNDGLTFPEKT
LKEYITLLFCVPVPM
Reference
  Authors
Gopfert JC, Macnevin G, Ro DK, Spring O
  Title
Identification, functional characterization and developmental regulation of sesquiterpene synthases from sunflower capitate glandular trichomes.
  Journal
BMC Plant Biol 9:86 (2009)
DOI:10.1186/1471-2229-9-86

DBGET integrated database retrieval system