KEGG   Addendum: ABY66020Help
Entry
ABY66020          CDS       T10000                                 

Gene name
mdpB1
Definition
(KEGG) methyltransferase
  KO
K21192  methyltransferase [EC:2.1.1.-]
Taxonomy
TAX:1993
  Lineage
Bacteria; Actinobacteria; Streptosporangiales; Thermomonosporaceae; Actinomadura
Organism
ag  Addendum (Actinomadura madurae)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_2 Methyltransf_25 Dimerisation2 Methyltransf_11 Methyltransf_12 MTS Methyltransf_23 Methyltransf_31 TehB PCMT CMAS Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: ABY66020
GB: AY271660
UniProt: B0BLM5
AA seq 348 aa AA seqDB search
MVDSRTVTVSEADYLRLIIHGTTAFELLRTALEFELFELLETAGGMDVAETAAALGVDEQ
PARILLLGLTSMKLLERREDGYANSAVARDRLLRSGRRFLGPLVDVQAEVINRALPDFAE
AMRRNTNVGLRHITGPGTTLYERLTAHPDLQRIFYANMGDASRYAFAQLLDLYDFSGVRH
VLDLGGGDGTNSLHLARRRPGLEATVFDQESVVRLAADRIEDPDLRKRVHFHAGDLFADP
FPDGCDAILYFHIFEIWSLERNTELLRKCHAALPEGGVCVVYNFTSDDAGTGPMSAGLVS
PYFLTLASGEGMAYAPDDMERAVRDAGFSRVDRRQDLGFGHTLVVGRK
Reference
  Authors
Van Lanen SG, Oh TJ, Liu W, Wendt-Pienkowski E, Shen B
  Title
Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis.
  Journal
J Am Chem Soc 129:13082-94 (2007)
DOI:10.1021/ja073275o

DBGET integrated database retrieval system