KEGG   Addendum: ACI43096Help
Entry
ACI43096          CDS       T10000                                 

Gene name
fgaMT
Definition
(KEGG) 4-dimethylallyltryptophan N-methyltransferase (EC:2.1.1.261)
  KO
K18884  4-dimethylallyltryptophan N-methyltransferase [EC:2.1.1.261]
Taxonomy
TAX:746128
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus
Organism
ag  Addendum (Aspergillus fumigatus)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: ACI43096
GB: EU827256
UniProt: B6D5I7
AA seq 339 aa AA seqDB search
MTISAPPIIDIRQAGLESSIPDQVVEGLTKEVKTLPALLFYSTKGIQHWNRHSHAADFYP
RHEELCILKAEASKMAASIAQDSLVIDMGSASMDKVILLLEALEEQKKSITYCALDLSYS
ELASNFQAIPVDRFHYVRFAALHGTFDDGLHWLQNAPDIRNRPRCILLFGLTIGNFSRDN
AASFLRNIAQSALSTSPTQSSIIVSLDSCKLPTKILRAYTADGVVPFALASLSYANSLFH
PKGDRKIFNEEDWYFHSEWNHALGRHEASLITQSKDIQLGAPLETVIVRRDEKIRFGCSY
KYDKAERDQLFHSAGLEDAAVWTAPDCDVAFYQLRLRLN
Reference
  Authors
Rigbers O, Li SM
  Title
Ergot alkaloid biosynthesis in Aspergillus fumigatus. Overproduction and biochemical characterization of a 4-dimethylallyltryptophan N-methyltransferase.
  Journal
J Biol Chem 283:26859-68 (2008)
DOI:10.1074/jbc.M804979200

DBGET integrated database retrieval system