KEGG   Addendum: ADF32078
Entry
ADF32078          CDS       T10000                                 

Gene name
GAO1
Definition
(KEGG) germacrene A oxidase (EC:1.14.14.95)
  KO
K15800  germacrene A oxidase [EC:1.14.14.95]
Taxonomy
TAX:4236
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Organism
ag  Addendum (Lactuca sativa)
SSDB
Motif
Pfam: p450 DUF1323
Other DBs
NCBI-ProteinID: ADF32078
GB: GU198171
UniProt: D5J9U8
AA seq 488 aa
MELSITTSIALATIVFFLYKLATRPKSTKKQLPEASRLPIIGHMHHLIGTMPHRGVMDLA
RKHGSLMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPY
GEYWRQLRKLCTLELLSVKKVKSFQSIREEECWNLVKEVKESGSGKPINLSESIFTMIAT
ILSRAAFGKGIKDQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKL
DNLINNIVAEHHVSTSSKANETLLDVLLRLKDSAEFPLTADNVKAIILDMFGAGTDTSSA
TVEWAISELIRCPRAMEKVQAELRQALNGKEKIQEEDIQDLAYLNLVIRETLRLHPPLPL
VMPRECREPVNLAGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIMGADY
EYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGATVQRKT
ELLLVPSF
Reference
  Authors
Nguyen DT, Gopfert JC, Ikezawa N, Macnevin G, Kathiresan M, Conrad J, Spring O, Ro DK
  Title
Biochemical conservation and evolution of germacrene A oxidase in asteraceae.
  Journal
J Biol Chem 285:16588-98 (2010)
DOI:10.1074/jbc.M110.111757

DBGET integrated database retrieval system