KEGG   Addendum: ADF43080
Entry
ADF43080          CDS       T10000                                 

Gene name
CiGAO
Definition
(KEGG) germacrene A oxidase (EC:1.14.14.95)
  KO
K15800  germacrene A oxidase [EC:1.14.14.95]
Taxonomy
TAX:13427
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Cichoriinae; Cichorium
Organism
ag  Addendum (Cichorium intybus)
SSDB
Motif
Pfam: p450 DUF1323
Other DBs
NCBI-ProteinID: ADF43080
GB: GU256644
UniProt: D5JBW8
AA seq 488 aa
MELSLTTSIALATIVLILYKLATRPKSNKKRLPEASRLPIIGHMHHLIGTMPHRGVMELA
RKHGSLMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPY
GEYWRQLRKLCTLELLSVKKVKSFQSIREEECWNLVKEVKESGSGKPISLSESIFKMIAT
ILSRAAFGKGIKDQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKL
DTLINNIVAEHHVSTSSKANETLLDVLLRLKDSAEFPLTADNVKAIILDMFGAGTDTSSA
TVEWAISELIRCPRAMEKVQAELRQALNGKEQIHEEDIQDLPYLNLVIRETLRLHPPLPL
VMPRECREPVNLAGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIMGADY
EYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGATVQRKT
ELILVPSF
Reference
  Authors
Nguyen DT, Gopfert JC, Ikezawa N, Macnevin G, Kathiresan M, Conrad J, Spring O, Ro DK
  Title
Biochemical conservation and evolution of germacrene A oxidase in asteraceae.
  Journal
J Biol Chem 285:16588-98 (2010)
DOI:10.1074/jbc.M110.111757

DBGET integrated database retrieval system