KEGG   Addendum: ADL27533Help
Entry
ADL27533          CDS       T10000                                 

Gene name
VIM-24
Definition
(KEGG) metallo-beta-lactamase class B VIM-24
  KO
K18781  metallo-beta-lactamase class B VIM [EC:3.5.2.6]
Taxonomy
TAX:573
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella
Organism
ag  Addendum (Klebsiella pneumoniae)
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: ADL27533
GB: HM855205
UniProt: E0AFT6
Structure
PDB: 

AA seq 266 aa AA seqDB search
MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV
GGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSASVLYGGCAIYELSLTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGH
GLPGGLDLLKHTTNVVKAHTNRSVVE
Reference
  Authors
Montealegre MC, Correa A, Briceno DF, Rosas NC, De La Cadena E, Ruiz SJ, Mojica MF, Camargo RD, Zuluaga I, Marin A, Quinn JP, Villegas MV
  Title
Novel VIM metallo-beta-lactamase variant, VIM-24, from a Klebsiella pneumoniae isolate from Colombia.
  Journal
Antimicrob Agents Chemother 55:2428-30 (2011)
DOI:10.1128/AAC.01208-10

DBGET integrated database retrieval system