KEGG   Addendum: ADR72965
Entry
ADR72965          CDS       T10000                                 

Gene name
cypD
Definition
(KEGG) cypemycin cysteine dehydrogenase (decarboxylating) (EC:1.3.99.36)
  KO
K21818  cypemycin cysteine dehydrogenase (decarboxylating) [EC:1.3.99.36]
Taxonomy
TAX:932694
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces sp. OH-4156)
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-ProteinID: ADR72965
GB: HQ148718
UniProt: E5KIB9
AA seq 190 aa
MNVEKFEGAELHVHVTGSISAALVPWWIHWLREFQPELVVNVSVTPAASRFLAVRALRHL
ANGKVWVDSWDDPDVPPEVNSGKSGASECFLVFPATLDTVMRLAQGRADSPALMMLQLTD
APLVIADTFPGSNEIVENNVQTLKLRPNVEFAPRVNGVRASNRQTAEVGFNLPGALAAAN
RMRKEGRSGE
Reference
  Authors
Claesen J, Bibb M
  Title
Genome mining and genetic analysis of cypemycin biosynthesis reveal an unusual class of posttranslationally modified peptides.
  Journal
Proc Natl Acad Sci U S A 107:16297-302 (2010)
DOI:10.1073/pnas.1008608107

DBGET integrated database retrieval system