KEGG   Addendum: AEQ59233
Entry
AEQ59233          CDS       T10000                                 

Gene name
IDOLDH
Definition
(KEGG) ipsdienol dehydrogenase (EC:1.1.1.386)
  KO
K20142  ipsdienol dehydrogenase [EC:1.1.1.386]
Taxonomy
TAX:102803
  Lineage
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Holometabola; Coleoptera; Polyphaga; Cucujiformia; Curculionidae; Scolytinae; Ips
Organism
ag  Addendum (Ips pini)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 NAD_binding_7 Polysacc_synt_2 3Beta_HSD
Other DBs
NCBI-ProteinID: AEQ59233
GB: JN653323
UniProt: G5DGA8
AA seq 253 aa
MMVKIQDSVYLVTGGGSGLGEATAKLLLTEGARVTIFSRNEYKNEFPHDQVLSVKGDVRS
ESDVKRALEATIQKFGKLDGVMHCAGVFQNGDELFNMDTQQPGDYTVLTDIVTTNLLGTF
NVNRLAIPYFLTNQPDEEGQKGIIINCSSTSGHSPMSSAVAYSTSKAAIIGLSYALAKQL
STLGIRVMDIAPALCDTPMFRRAVGFNQDIANFRNLFPARLIQPIEYANAVKHIIETPML
NGSSYQLDGALRP
Reference
  Authors
Figueroa-Teran R, Welch WH, Blomquist GJ, Tittiger C
  Title
Ipsdienol dehydrogenase (IDOLDH): a novel oxidoreductase important for Ips pini pheromone production.
  Journal
Insect Biochem Mol Biol 42:81-90 (2012)
DOI:10.1016/j.ibmb.2011.10.009

DBGET integrated database retrieval system