KEGG   Addendum: AEY75212
Entry
AEY75212          CDS       T10000                                 

Gene name
PPDS
Definition
(KEGG) dammarenediol 12-hydroxylase (EC:1.14.14.120)
  KO
K20545  dammarenediol 12-hydroxylase [EC:1.14.14.120]
Taxonomy
TAX:4054
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Araliaceae; Panax
Organism
ag  Addendum (Panax ginseng)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AEY75212
GB: JN604536
UniProt: H2DH16
AA seq 486 aa
MAAAMVLFFSLSLLLLPLLLLFAYFSYTKRIPQKENDSKAPLPPGQTGWPLIGETLNYLS
CVKSGVSENFVKYRKEKYSPKVFRTSLLGEPMAILCGPEGNKFLYSTEKKLVQVWFPSSV
EKMFPRSHGESNADNFSKVRGKMMFLLKVDGMKKYVGLMDRVMKQFLETDWNRQQQINVH
NTVKKYTVTMSCRVFMSIDDEEQVTRLGSSIQNIEAGLLAVPINIPGTAMNRAIKTVKLL
TREVEAVIKQRKVDLLENKQASQPQDLLSHLLLTANQDGQFLSESDIASHLIGLMQGGYT
TLNGTITFVLNYLAEFPDVYNQVLKEQVEIANSKHPKELLNWEDLRKMKYSWNVAQEVLR
IIPPGVGTFREAITDFTYAGYLIPKGWKMHLIPHDTHKNPTYFPSPEKFDPTRFEGNGPA
PYTFTPFGGGPRMCPGIEYARLVILIFMHNVVTNFRWEKLIPNEKILTDPIPRFAHGLPI
HLHPHN
Reference
  Authors
Han JY, Kim HJ, Kwon YS, Choi YE
  Title
The Cyt P450 enzyme CYP716A47 catalyzes the formation of protopanaxadiol from dammarenediol-II during ginsenoside biosynthesis in Panax ginseng.
  Journal
Plant Cell Physiol 52:2062-73 (2011)
DOI:10.1093/pcp/pcr150

DBGET integrated database retrieval system