KEGG   Addendum: AFD54464Help
Entry
AFD54464          CDS       T10000                                 

Gene name
sap
Definition
(KEGG) 3-succinoylsemialdehyde-pyridine dehydrogenase (EC:1.2.1.83)
  KO
K19700  3-succinoylsemialdehyde-pyridine dehydrogenase [EC:1.2.1.83]
Taxonomy
TAX:879273
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp. HZN6)
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFD54464
GB: JN391188
UniProt: H8ZPX2
AA seq 477 aa AA seqDB search
MRDYREFYIDGQWVRPKGAREAEVINPATEKIVGLISLGTEEHVDLAVRAARRAFDGWSR
TSKDQRLELLEQVCRAFESKLDEIAKAITEEMGAPLVQLALPLQAPAGLGHFLTAASILR
DYDFEESLGTTRVVREPAGVCGLITPWNWPLNQIAAKVAPALAAGCTMVLKPSEIAPFSA
YLLARIFDEVGVPPGVFNLVNGDGPGVGAPLAAHPEVDLVSFTGSTRAGTLVSTAAAPTV
KRVALELGGKSANIILDDADLETAVKHGVRTMMLNTGQSCNAPSRMLVPLSKLDEVEHLA
EHFCKEIVVGDPMHSDTNIGPLASGMQYEKVQDCIRQGVAEGAKLICGGLGRPDGLESGY
FAQPTIFSAVNKQMYIAREEIFGPVLCIMPYGDENEAIQIANDSCYGLSGYVSSGSLERA
RNVAKQLRTGAVHLNGAALDFTAPFGGYKQSGNGREWGKYGFEEFLEIKAVMGYEGS
Reference
  Authors
Qiu J, Ma Y, Wen Y, Chen L, Wu L, Liu W
  Title
Functional identification of two novel genes from Pseudomonas sp. strain HZN6 involved in the catabolism of nicotine.
  Journal
Appl Environ Microbiol 78:2154-60 (2012)
DOI:10.1128/AEM.07025-11

DBGET integrated database retrieval system