KEGG   Addendum: AFM43735Help
Entry
AFM43735          CDS       T10000                                 

Definition
(KEGG) alpha-isocomene synthase (EC:4.2.3.136)
  KO
K21983  alpha-isocomene synthase [EC:4.2.3.136]
Taxonomy
TAX:98504
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Matricariinae; Matricaria
Organism
ag  Addendum (Matricaria chamomilla)
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-ProteinID: AFM43735
GB: JQ255376
UniProt: I6R4V5
AA seq 546 aa AA seqDB search
MSLQENVIRPTANFPPSVWGDQFLTYDEREDQAGLEKVVEDLKDKVRQEILGTLDVPSQH
TDLLRLIDSIQRLGIAYHFEEEIDRTLHHFYDAYGDNWTGGATSVWFRIMRQHGFFVSSD
VFKSYKDKNGAFKEPLENDIVGFLELYEATYLRVPGEVILDDALVFTKGRLGEISNDPLW
RNSIVSTQIIEALEQPVQKRLHRHEALRYITFYQQQASCNESLLKLAKLGFNLLQSLHKK
ELSQVYKWWKGFDVPTNLPYARNRMVECYFWSLSVFFEPKYSESRMFLAKVFAVETILDD
TYDAFGTYEELEIFTAAVHRSSVTCLDALPKNYKLIYRIILSLYEDMEKILTKMGKAHHL
NYIRNAMMEYIGCYLKEAKWANDEYTPTMEEHKEVTTVSSGYKFSLIASFAAMGDAITDE
TFKWALTMPPLAKACCVLCRVMDDIVTHKEEQERKHVASGIQCYMKEFDVTEQHVYDVFN
AKVEDAWVEMNEESLKCKDVKRPVIMRVINLARAMDVLYKNKDHYTHVGPELINHIKSLV
VDPIMA
Reference
  Authors
Irmisch S, Krause ST, Kunert G, Gershenzon J, Degenhardt J, Kollner TG
  Title
The organ-specific expression of terpene synthase genes contributes to the terpene hydrocarbon composition of chamomile essential oils.
  Journal
BMC Plant Biol 12:84 (2012)
DOI:10.1186/1471-2229-12-84

DBGET integrated database retrieval system