KEGG   Addendum: AIE12479
Entry
AIE12479          CDS       T10000                                 

Gene name
UGTPg1
Definition
(KEGG) ginsenoside 20-O-glucosyltransferase (EC:2.4.1.363)
  KO
K23520  ginsenoside 20-O-glucosyltransferase [EC:2.4.1.363]
Taxonomy
TAX:4054
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Araliaceae; Panax
Organism
ag  Addendum (Panax ginseng)
SSDB
Motif
Pfam: UDPGT YabA
Other DBs
NCBI-ProteinID: AIE12479
GB: KF377585
UniProt: A0A068J840
AA seq 475 aa
MKSELIFLPAPAIGHLVGMVEMAKLFISRHENLSVTVLIAKFYMDTGVDNYNKSLLTNPT
PRLTIVNLPETDPQNYMLKPRHAIFPSVIETQKTHVRDIISGMTQSESTQVVGLLADLLF
INIMDIANEFNVPTYVYSPAGAGHLGLAFHLQTLNDKKQDVTEFRNSDTELLVPSFANPV
PAEVLPSMYVDKEGGYDYLFSLFRRCRESKAIIINTFEELEPYAINSLRMDSMIPPIYPV
GPILNLNGDGQNSDEAAVILGWLDDQPPSSVVFLCFGSYGSFQENQVKEIAMGLERSGHR
FLWSLRPSIPKGETKLQLKYSNLKEILPVGFLDRTSCVGKVIGWAPQVAVLGHESVGGFL
SHCGWNSTLESVWCGVPVATWPMYGEQQLNAFEMVKELGIAVEIEVDYKKDYFNMKNDFI
VRAEEIETKIKKLMMDENNSEIRKKVKEMKEKSRAAMSENGSSYNSLAKLFEEIM
Reference
  Authors
Yan X, Fan Y, Wei W, Wang P, Liu Q, Wei Y, Zhang L, Zhao G, Yue J, Zhou Z
  Title
Production of bioactive ginsenoside compound K in metabolically engineered yeast.
  Journal
Cell Res 24:770-3 (2014)
DOI:10.1038/cr.2014.28

DBGET integrated database retrieval system