KEGG   Addendum: BAA05965Help
Entry
BAA05965          CDS       T10000                                 

Definition
(KEGG) beta-pyrazolylalanine/L-mimosine synthase (EC:2.5.1.51 2.5.1.52)
Taxonomy
TAX:3654
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Organism
ag  Addendum (Citrullus lanatus)
SSDB OrthologParalogGFIT
Motif
Pfam: PALP ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: BAA05965
GB: D28777
UniProt: Q43317
AA seq 325 aa AA seqDB search
MADAKSTIAKDVTELIGNTPLVYLNRVVDGCVARVAAKLEMMEPCSSVKDRIGYSMISDA
ENKGLITPGESVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASMSLERRTILRAFGAELV
LTDPARGMKGAVQKAEEIKAKTPNSYILQQFENPANPKIHYETTGPEIWRGSGGKIDALV
SGIGTGGTVTGAGKYLKEQNPNIKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPGVLDV
NLLDEVIQVSSEESIETAKLLALKEGLLVGISSGAAAAAAIRIAKRPENAGKLIVAVFPS
FGERYLSTVLFESVKRETENMVFEP
Reference
PMID:8041362
  Authors
Noji M, Murakoshi I, Saito K
  Title
Molecular cloning of a cysteine synthase cDNA from Citrullus vulgaris (watermelon) by genetic complementation in an Escherichia coli Cys- auxotroph.
  Journal
Mol Gen Genet 244:57-66 (1994)
DOI:10.1007/BF00280187
Reference
PMID:8280125
  Authors
Noji M, Murakoshi I, Saito K
  Title
Evidence for identity of beta-pyrazolealanine synthase with cysteine synthase in watermelon: formation of beta-pyrazole-alanine by cloned cysteine synthase in vitro and in vivo.
  Journal
Biochem Biophys Res Commun 197:1111-7 (1993)
DOI:10.1006/bbrc.1993.2592

DBGET integrated database retrieval system