KEGG   Addendum: BAA23334
Entry
BAA23334          CDS       T10000                                 

Gene name
dsoE
Definition
(KEGG) assimilatory dimethylsulfide S-monooxygenase DsoE (EC:1.14.13.245)
  KO
K16245  phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243]
Taxonomy
TAX:472
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter
Organism
ag  Addendum (Acinetobacter sp.)
SSDB
Motif
Pfam: Phenol_monoox SYCE1
Other DBs
NCBI-ProteinID: BAA23334
GB: D85083
UniProt: O32432
AA seq 120 aa
MTVQAIVEKYQFEPLDLQQNYGENMLLFIGWDHHTLFCSAHAFVVSPKQSLQALIDGQIQ
AGFEQHPDFKHIDWSKVEFRLNRKLLQADFSKSLEDLGFDHKSLLRFVTPDLTGYQGTHV
Reference
PMID:9345770
  Authors
Horinouchi M, Kasuga K, Nojiri H, Yamane H, Omori T
  Title
Cloning and characterization of genes encoding an enzyme which oxidizes dimethyl sulfide in Acinetobacter sp. strain 20B.
  Journal
FEMS Microbiol Lett 155:99-105 (1997)
DOI:10.1111/j.1574-6968.1997.tb12692.x

DBGET integrated database retrieval system