KEGG   Addendum: BAA85463Help
Entry
BAA85463          CDS       T10000                                 

Gene name
CYP2A16
Definition
(KEGG) cytochrome P450 2A16
  KO
K07411  cytochrome P450 family 2 subfamily A [EC:1.14.14.1]
Taxonomy
TAX:10036
  Lineage
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Cricetinae; Mesocricetus
Organism
ag  Addendum (Mesocricetus auratus)
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: BAA85463
GB: D86952
UniProt: Q9QZ50
AA seq 494 aa AA seqDB search
MLASGLLLVTVLAFLVVLILMSVWKQRKLSGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRPIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSS
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLLEAFRKTNGALIDPTFYLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTGTSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMKEEKKNPNTEFYMKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKHPDVEAKVQEEIDRVIGKNRQPKYEDRLKMPYTEAVIHEIQ
RFGDMIPMGLARRVTKDTKFRGFFIPKGTEVFPMLGSVLRDPKFFSNPKDFNPQHFLDDK
GQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNILQNFHLRSPQAPQDIDVSPRLVGF
ATIPPNYTMSFLSR
Reference
  Authors
Tohkin M, Kurose K, Isozaki E, Fukuhara M
  Title
Molecular cloning, heterologous expression, and characterization of a novel member of CYP2A in the Syrian hamster.
  Journal
Biochim Biophys Acta 1446:438-42 (1999)
DOI:10.1016/S0167-4781(99)00109-8

DBGET integrated database retrieval system