KEGG   Addendum: BAA89815Help
Entry
BAA89815          CDS       T10000                                 

Gene name
GgbAS1
Definition
(KEGG) beta-amyrin synthase (EC:5.4.99.39)
  KO
K15813  beta-amyrin synthase [EC:5.4.99.39]
Taxonomy
TAX:49827
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Galegeae; Glycyrrhiza
Organism
ag  Addendum (Glycyrrhiza glabra)
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement
Motif
Other DBs
NCBI-ProteinID: BAA89815
GB: AB037203
UniProt: Q9MB42
AA seq 765 aa AA seqDB search
MWRLKIAEGGKDPYIYSTNNFVGRQTWEYDPDGGTPEERAQVDAARLHFYNNRFQVKPCG
DLLWRFQILRENNFKQTIASVKIGDGEEITYEKATTAVRRAAHHLSALQTSDGHWPAQIA
GPLFFLPPLVFCMYITGHLDSVFPEEYRKEILRYIYYHQNEDGGWGLHIEGHSTMFCTAL
NYICMRILGEGPDGGQDNACARARKWIHDHGGVTHIPSWGKTWLSILGVFDWCGSNPMPP
EFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTEPYEKVNW
KKARHQCAKEDLYYPHPLLQDLIWDSLYLFTEPLLTRWPFNKLVREKALQVTMKHIHYED
ETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEWDA
GFAVQALLATNLVEEIAPTLAKGHDFIKKSQVRDNPSGDFKSMYRHISKGSWTFSDQDHG
WQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQSKKGGLSAWEPAGAQ
EWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIANAVRFLED
TQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTFANCAAIRKAVKFLLTTQREDGGWGES
YLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQAERDPAPLHRAAKLIINSQLEEGDWP
QQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPVCLT
Reference
  Authors
Hayashi H, Huang P, Kirakosyan A, Inoue K, Hiraoka N, Ikeshiro Y, Kushiro T, Shibuya M, Ebizuka Y
  Title
Cloning and characterization of a cDNA encoding beta-amyrin synthase involved in glycyrrhizin and soyasaponin biosyntheses in licorice.
  Journal
Biol Pharm Bull 24:912-6 (2001)
DOI:10.1248/bpb.24.912
Reference
  Authors
Hayashi H, Huang P, Takada S, Obinata M, Inoue K, Shibuya M, Ebizuka Y
  Title
Differential expression of three oxidosqualene cyclase mRNAs in Glycyrrhiza glabra.
  Journal
Biol Pharm Bull 27:1086-92 (2004)
DOI:10.1248/bpb.27.1086

DBGET integrated database retrieval system