KEGG   Addendum: BAA96298Help
Entry
BAA96298          CDS       T10000                                 

Gene name
barS1
Definition
(KEGG) A-factor type gamma-butyrolactone 1'-reductase (1S-forming) (EC:1.1.1.413)
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Taxonomy
TAX:1961
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces virginiae)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAA96298
GB: AB035548
UniProt: Q9LBV3
AA seq 257 aa AA seqDB search
MTDRQGLLTDRIALITGASSGIGAAQRGLFAREGAAVVVTARREERLAGLVDELRAQGAR
AAYVVADVTRSEDAVRAVEFTVERFGRLDAAFNKRRHGAGRTPLHLMDDPVYDDIMDTNV
RGVFNCLRPEIAAMLASGAGGSIVNTSSTGGLVATPVAAPYVVSKHAVLGLTKGPAAEYG
AHGIRVNAIAPGTTRSEMVADWFAQNPDAEELLHRATPQPRTAEPQEIAEAAAWLCSERA
SFVTGSTLVVDGGFTIL
Reference
  Authors
Kawachi R, Akashi T, Kamitani Y, Sy A, Wangchaisoonthorn U, Nihira T, Yamada Y
  Title
Identification of an AfsA homologue (BarX) from Streptomyces virginiae as a pleiotropic regulator controlling autoregulator biosynthesis, virginiamycin biosynthesis and virginiamycin M1 resistance.
  Journal
Mol Microbiol 36:302-13 (2000)
DOI:10.1046/j.1365-2958.2000.01819.x
Reference
  Authors
Shikura N, Yamamura J, Nihira T
  Title
barS1, a gene for biosynthesis of a gamma-butyrolactone autoregulator, a microbial signaling molecule eliciting antibiotic production in Streptomyces species.
  Journal
J Bacteriol 184:5151-7 (2002)
DOI:10.1128/JB.184.18.5151-5157.2002

DBGET integrated database retrieval system