KEGG   Addendum: BAB12024Help
Entry
BAB12024          CDS       T10000                                 

Gene name
PNO
Definition
(KEGG) pyruvate dehydrogenase (NADP+) / aquacobalamin reductase (NADPH) (EC:1.2.1.51 1.16.1.5)
  KO
K21682  pyruvate dehydrogenase (NADP+) / aquacobalamin reductase (NADPH) [EC:1.2.1.51 1.16.1.5]
Taxonomy
TAX:3039
  Lineage
Eukaryota; Euglenozoa; Euglenoida; Spirocuta; Euglenida; Euglenales; Euglenaceae; Euglena
Organism
ag  Addendum (Euglena gracilis)
SSDB OrthologParalogGFIT
Motif
Pfam: POR_N FAD_binding_1 Flavodoxin_1 POR EKR TPP_enzyme_C PFOR_II NAD_binding_1 Fer4_7 Fer4_21 Fer4_9 Fer4_16 Fer4_10 Fer4 Fer4_17 Fer4_6 Fer4_8 Fer4_4 Fer4_2 Flavodoxin_3 APP_E2 Fer4_18
Motif
Other DBs
NCBI-ProteinID: BAB12024
GB: AB021127
UniProt: Q94IN5
AA seq 1803 aa AA seqDB search
MKQSVRPIISNVLRKEVALYSTIIGQDKGKEPTGRTYTSGPKPASHIEVPHHVTVPATDR
TPNPDAQFFQSVDGSQATSHVAYALSDTAFIYPITPSSVMGELADVWMAQGRKNAFGQVV
DVREMQSEAGAAGALHGALAAGAIATTFTASQGLLLMIPNMYKIAGELMPSVIHVAAREL
AGHALSIFGGHADVMAVRQTGWAMLCSHTVQQSHDMALISHVATLKSSIPFVHFFDGFRT
SHEVNKIKMLPYAELKKLVPPGTMEQHWARSLNPMHPTIRGTNQSADIYFQNMESANQYY
TDLAEVVQETMDEVAPYIGRHYKIFEYVGAPDAEEVTVLMGSGATTVNEAVDLLVKRGKK
VGAVLVHLYRPWSTKAFEKVLPKTVKRIAALDRCKEVTALGEPLYLDVSATLNLFPERQN
VKVIGGRYGLGSKDFIPEHALAIYANLASENPIQRFTVGITDDVTGTSVPFVNERVDTLP
EGTRQCVFWGIGSDGTVGANRSAVRIIGDNSDLMVQAYFQFDAFKSGGVTSSHLRFGPKP
ITAQYLVTNADYIACHFQEYVKRFDMLDAIREGGTFVLNSRWTTEDMEKEIPADFRRKLA
QKKVRFYNVDARKICDSFGLGKRINMLMQACFFKLSGVLPLAEAQRLLNESIVHEYGKKG
GKVVEMNQAVVNAVFAGDLPQEVQVPAAWANAVDTSTRTPTGIEFVDKIMRPLMDFKGDQ
LPVSVMTPGGTFPVGTTQYAKRAIAAFIPQWIPANCTQCNYCSYVCPHATIRPFVLTDQE
VQLAPESFVTRKAKGDYQGMNFRIQVAPEDCTGCQVCVETCPDDALEMTDAFTATPVQRT
NWEFAIKVPNRGTMTDRYSLKGSQFQQPLLEFSGACEGCGETPYVKLLTQLFGERTVIAN
ATGCSSIWGGTAGLAPYTTNAKGQGPAWGNSLFEDNAEFGFGIAVANAQKRSRVRDCILQ
AVEKKVADEGLTTLLAQWLQDWNTGDKTLKYQDQIIAGLAQQRSKDPLLEQIYGMKDMLP
NISQWIIGGDGWANDIGFGGLDHVLASGQNLNVLVLDTEMYSNTGGQASKSTHMASVAKF
ALGGKRTNKKNLTEMAMSYGNVYVATVSHGNMAQCVKAFVEAESYDGPSLIVGYAPCIEH
GLRAGMARMVQESEAAIATGYWPLYRFDPRLATEGKNPFQLDSKRIKGNLQEYLDRQNRY
VNLKKNNPKGADLLKSQMADNITARFNRYRRMLEGPNTKAAAPSGNHVTILYGSETGNSE
GLAKELATDFERREYSVAVQALDDIDVADLENMGFVVIAVSTCGQGQFPRNSQLFWRELQ
RDKPEGWLKNLKYTVFGLGDSTYYFYCHTAKQIDARLAALGAQRVVPIGFGDDGDEDMFH
TGFNNWIPSVWNELKTKTPEEALFTPSIAVQLTPNATPQDFHFAKSTPVLSITGAERITP
ADHTRNFVTIRWKTDLSYQVGDSLGVFPENTRSVVEEFLQYYGLNPKDVITIENKGSREL
PHCMAVGDLFTKVLDILGKPNNRFYKTLSYFAVDKAEKERLLKIAEMGPEYSNILSETYH
YADIFHMFPSARPTLQYLIEMIPNIKPRYYSISSAPIHTPGEVHSLVLIDTWITLSGKHR
TGLTCTMLEHLQAGQVVDGCIHPTAMEFPDHEKPVVMCAMGSGLAPFVAFLRDGSTLRKQ
GKKTGNMALYFGNRYEKTEFLMKEELKGHINDGLLTLRCAFSRDDPKKKVYVQDLIKMDE
KMMYDYLVVQKGSMYCCGSRSFIKPVQESLKHCFMKAGGLTAEQAENEVIDMFTTGRYNI
EAW
Reference
  Authors
Nakazawa M, Inui H, Yamaji R, Yamamoto T, Takenaka S, Ueda M, Nakano Y, Miyatake K
  Title
The origin of pyruvate: NADP+ oxidoreductase in mitochondria of Euglena gracilis.
  Journal
FEBS Lett 479:155-6 (2000)
DOI:10.1016/S0014-5793(00)01882-2
Reference
PMID:8373179
  Authors
Watanabe F, Yamaji R, Isegawa Y, Yamamoto T, Tamura Y, Nakano Y
  Title
Characterization of aquacobalamin reductase (NADPH) from Euglena gracilis.
  Journal
Arch Biochem Biophys 305:421-7 (1993)
DOI:10.1006/abbi.1993.1441
Reference
PMID:3110154
  Authors
Inui H, Ono K, Miyatake K, Nakano Y, Kitaoka S
  Title
Purification and characterization of pyruvate:NADP+ oxidoreductase in Euglena gracilis.
  Journal
J Biol Chem 262:9130-5 (1987)

DBGET integrated database retrieval system