KEGG   Addendum: BAC41251Help
Entry
BAC41251          CDS       T10000                                 

Gene name
inhA
Definition
(KEGG) cyclohexyl-isocyanide hydratase (EC:4.2.1.103)
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Taxonomy
TAX:303
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas putida)
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: BAC41251
GB: AB088117
UniProt: Q8G9F9
AA seq 228 aa AA seqDB search
MALQIGFLLFPQVQQLDLTGPYDVLASLPDVQVHLVWKDLVPVTSSTGLQLKPTTTFEDC
PVLDVICVPGGAGVGPLMEDEQTLDFIRSQAAQARYVTSVCTGSLVLGAAGLLQGKRATT
HWAYHDLLPTLGAIPVKDRVVRDGNLFTGGGITAGIDFALTLAQELVGVDTAQLVQLQLE
YAPAPPFDSGSPDTAPSAVVDEARKRAAPSLKLRTEITERAAAKLNLR
Reference
  Authors
Goda M, Hashimoto Y, Takase M, Herai S, Iwahara Y, Higashibata H, Kobayashi M
  Title
Isonitrile hydratase from Pseudomonas putida N19-2. Cloning, sequencing, gene expression, and identification of its active acid residue.
  Journal
J Biol Chem 277:45860-5 (2002)
DOI:10.1074/jbc.M208571200
Reference
  Authors
Goda M, Hashimoto Y, Shimizu S, Kobayashi M
  Title
Discovery of a novel enzyme, isonitrile hydratase, involved in nitrogen-carbon triple bond cleavage.
  Journal
J Biol Chem 276:23480-5 (2001)
DOI:10.1074/jbc.M007856200

DBGET integrated database retrieval system