KEGG   Addendum: BAD30041Help
Entry
BAD30041          CDS       T10000                                 

Gene name
npcB
Definition
(KEGG) 4-nitrocatechol 4-monooxygenase reductase component
  KO
K21727  4-nitrophenol 2-monooxygenase / 4-nitrocatechol 4-monooxygenase, reductase component
Taxonomy
TAX:37919
  Lineage
Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus
Organism
ag  Addendum (Rhodococcus opacus)
SSDB OrthologParalogGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-ProteinID: BAD30041
GB: AB154422
UniProt: Q6F4M9
AA seq 185 aa AA seqDB search
MLEDPMKQNVLQPLDKAEFRNVVGHFASGVTIVTAAHDGVPYGATISAVTSLCDTPPMVL
VCLNQKLGTHAAIRKARHFTINILGEDQASLAHTFATPGADKFADVAVHHRQHGPRLAEA
LAYLTCRVVDDLEGGTHRIFVAEVVEAQAGTGNPLSYYRGRFGHFVPYRNAMWRTTQADN
AVSPH
Reference
  Authors
Kitagawa W, Kimura N, Kamagata Y
  Title
A novel p-nitrophenol degradation gene cluster from a gram-positive bacterium, Rhodococcus opacus SAO101.
  Journal
J Bacteriol 186:4894-902 (2004)
DOI:10.1128/JB.186.15.4894-4902.2004

DBGET integrated database retrieval system