KEGG   Addendum: BAD89275Help
Entry
BAD89275          CDS       T10000                                 

Gene name
HMT
Definition
(KEGG) 13-hydroxylupinine O-tigloyltransferase (EC:2.3.1.93)
  KO
K13610  13-hydroxylupinine O-tigloyltransferase [EC:2.3.1.93]
Taxonomy
TAX:3870
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; genistoids sensu lato; core genistoids; Genisteae; Lupinus
Organism
ag  Addendum (Lupinus albus)
SSDB OrthologParalogGFIT
Motif
Pfam: Transferase GLTSCR1
Motif
Other DBs
NCBI-ProteinID: BAD89275
GB: AB181292
UniProt: Q5H873
AA seq 453 aa AA seqDB search
MAPQTQSLVFKVRRNPQELVTPAKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEG
KDPVEIIREALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGIDL
HPPFPCFDQLLYDVPGSDGILDSPLLLIQVTRLKCGGFIFAVRLNHAMCDAIGMSQFMKG
LAEIARGEPKPFILPVWHRELLCARNPPKVTFIHNEYQKPPHDNNNNNFILQHSSFFFGP
NELDAIRRLLPYHHSKSTTSDILTAFLWRCRTLALQPENPNHEFRLLYILNARYGRCSFN
PPLPEGFYGNAFVSPAAISTGEKLCNNPLEYALELMKEAKSKGTEEYVHSVADLMVIKGR
PSYFYNDVGYLEVSDLTKARFRDVDFGWGKAVYGGATQGYFSSILYVSYTNSKGVEGIMA
LTSLPTKAMERFEKELDDLFKTKDKSQILRSHI
Reference
  Authors
Okada T, Hirai MY, Suzuki H, Yamazaki M, Saito K
  Title
Molecular characterization of a novel quinolizidine alkaloid O-tigloyltransferase: cDNA cloning, catalytic activity of recombinant protein and expression analysis in Lupinus plants.
  Journal
Plant Cell Physiol 46:233-44 (2005)
DOI:10.1093/pcp/pci021
Reference
PMID:8195240
  Authors
Suzuki H, Murakoshi I, Saito K
  Title
A novel O-tigloyltransferase for alkaloid biosynthesis in plants. Purification, characterization, and distribution in Lupinus plants.
  Journal
J Biol Chem 269:15853-60 (1994)

DBGET integrated database retrieval system