KEGG   Addendum: BAF80442Help
Entry
BAF80442          CDS       T10000                                 

Gene name
M2
Definition
(KEGG) taraxerol synthase (EC:5.4.99.35)
  KO
K15819  taraxerol synthase [EC:5.4.99.35]
Taxonomy
TAX:98588
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Rhizophoraceae; Rhizophora
Organism
ag  Addendum (Rhizophora stylosa)
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans
Motif
Other DBs
NCBI-ProteinID: BAF80442
GB: AB263204
UniProt: A8C981
AA seq 771 aa AA seqDB search
MGVWRLKIGEGANNPYLTSTNNFVGRQTWVFEPDGGTPEERDQVEEARQNYFKNRFRVRP
CSDLLWQMQFLREKNFRQKIPQVKVRDGEEINYETVTNAIRRSAHYLSATQSSDGFWPAD
ASAPVFYLAPWVIGLYVIGHLNTVFPAEHQKEILRYIYCHQNEDGGWGLHYEDGGTMFGT
AFNYVCMRILGEGPGGGRDNACERARKGILDHGGVTYIPSGGKTWLAMLGVFDWSGCNPM
PPEFWMLPPFFPMHPAQMWCYCRIVYMPMSYLYGRRFVGPITPLVQQLREELHTQPFHEI
EWSKARHLCAKEDLFHRRPWIQELFWDCLHTFAEPLLTRWPLNNFIREKALKITMEHVHY
DDKASHYINPGSVEKVICMVACWVEDPSGEPFQRHLARISDYVWIAEDGMRITGIGSQTW
DAALSIQALIACNLIEEMGPTLKKGYDFLKNSQAKDNPPGDFKRMYRHFGKGAWAFSSQD
YGVIALDCTAESLMCCLHFSMMPPEIVGEKLEPEKLYLAVDFILSLQSKNGGLTCWEPAR
GGKWLEVLNPLEFFENIVVEHEYVEVTASAINALVMFKKRYPGYREKEIEHFISKAVHYL
IQTQFPNGPWYGVWGICFMYGTYFALKGLAAAGNTYANCPAIPKAVDFLLKTQCQDGGWG
ESYLSGTTKVYTPLEGNRSNLVQTAWALMGLIHSGQAERDPTPLHRSAKLLINSQTSDGD
FPQQDSTGLLKGSCAMHYAAYRNIFPLWALAAYRTHVLGLTSKAHSSAVME
Reference
  Authors
Basyuni M, Oku H, Tsujimoto E, Kinjo K, Baba S, Takara K
  Title
Triterpene synthases from the Okinawan mangrove tribe, Rhizophoraceae.
  Journal
FEBS J 274:5028-42 (2007)
DOI:10.1111/j.1742-4658.2007.06025.x

DBGET integrated database retrieval system