KEGG   Addendum: CAA23899Help
Entry
CAA23899          CDS       T10000                                 

Gene name
catI
Definition
(KEGG) chloramphenicol acetyltransferase
  KO
K19271  chloramphenicol O-acetyltransferase type A [EC:2.3.1.28]
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
ag  Addendum (Escherichia coli)
SSDB OrthologParalogGFIT
Motif
Pfam: CAT Condensation
Motif
Other DBs
NCBI-ProteinID: CAA23899
GB: V00622
UniProt: P62577
Structure
PDB: 

AA seq 219 aa AA seqDB search
MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFI
HILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIY
SQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQG
DKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA
Reference
PMID:390403
  Authors
Alton NK, Vapnek D
  Title
Nucleotide sequence analysis of the chloramphenicol resistance transposon Tn9.
  Journal
Nature 282:864-9 (1979)
DOI:10.1038/282864a0

DBGET integrated database retrieval system