KEGG   Addendum: CAA24743
Entry
CAA24743          CDS       T10000                                 

Symbol
aph(4)-Ia
Name
(KEGG) hygromycin 4-phosphotransferase
  KO
K18817  hygromycin-B 4-O-kinase [EC:2.7.1.163]
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
ag  Addendum (Escherichia coli)
SSDB
Motif
Pfam: APH RIO1 Choline_kinase
Other DBs
NCBI-ProteinID: CAA24743
GB: V01499
UniProt: P00557
Structure
AA seq 341 aa
MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKD
RYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMD
AIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDE
LMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLA
CMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSG
AGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE
Reference
PMID:6314265
  Authors
Kaster KR, Burgett SG, Rao RN, Ingolia TD
  Title
Analysis of a bacterial hygromycin B resistance gene by transcriptional and translational fusions and by DNA sequencing.
  Journal
Nucleic Acids Res 11:6895-911 (1983)
DOI:10.1093/nar/11.19.6895

DBGET integrated database retrieval system