KEGG   Addendum: CAA44952Help
Entry
CAA44952          CDS       T10000                                 

Gene name
EAPA
Definition
(KEGG) endothiapepsin (EC:3.4.23.22)
  KO
K20737  endothiapepsin [EC:3.4.23.22]
Taxonomy
TAX:5116
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Diaporthales; Cryphonectriaceae; Cryphonectria-Endothia species complex; Cryphonectria
Organism
ag  Addendum (Cryphonectria parasitica)
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N Asp_protease_2
Motif
Other DBs
NCBI-ProteinID: CAA44952
GB: X63351
UniProt: P11838
Structure
PDB: 
1OEW 1GVU 5MB5 1GVT 4Y5L 2JJJ 1GVW 1GVX 5P70 5P73 5LWS 5P71 5P77 5P8T 4Y4J 5P74 5P76 5MB3 5P6L 5P72 1GVV 5P4O 5P5V 5P6U 4Y45 5LWT 5P4M 5P5X 5P64 5P8R 4YCK 5P2S 5P4L 5P7F 5P2M 5P3Q 5P54 5P5H 5P5P 5P61 5P6G 5P2T 5P65 5P7G 5P7K 5P7U 4Y38 4Y3S 1OEX 5LWU 5P6N 5P7Q 5P8S 4Y4B 5OZU 5P0M 5P2L 5P2O 5P32 5P50 5P51 5P53 5P58 5P67 4Y5E 4Y3Z 4LAP 5P0T 5P19 5P4R 5P6F 5P6O 5P79 4YCT 4Y3G 4Y3R 5P0N 5P5S 5P5Y 5P8Q 5ISK 5MB0 5P0I 5P0J 5P4W 5DQ4 5P4G 5P6A 4Y3L 5P1Q 5P2R 5P3E 5P3S 5P48 5P5J 5P5Z 5P7D 5P7L 5HCO 4ZE6 4Y58 4Y3A 4Y3Q 5P3A 5P3D 5P42 5P44 5P46 5P47 5P59 5P5I 5P5M 5P5T 5P6Y 5P8D 5P39 5P3M 5P3T 5P43 5P45 5P66 5P7H 5P7I 5P7S 4Y5C 4Y47 5MB6 5P0S 5P1X 5P3U 5P3Z 5P4B 5P5O 5P63 5P6I 5P8M 4ZEA 4Y39 5P34 5P5B 5P6E 4YD5 5P3Y 5P82 5P88 5P8E 5P8I 5P8P 3PWW 5P1W 5P40 5P7E 5P85 5DR7 4Y5P 4Y3H 5OZE 5P14 5P35 5P3B 5P3W 5P60 5P6Q 5P80 5P8H 5P8L 5J25 5DR3 4Y5B 4Y44 5LWR 5OYU 5P0F 5P0R 5P1L 5P31 5P3I 5P3L 5P3O 5P4D 5P4N 5P4Z 5P68 5P7A 4YD3 4Y3E 4Y3X 4Y48 4LBT 3PCW 5P0Z 5P1F 5P25 5P33 5P3F 5P49 5P4C 5P5K 5P6J 5P7Z 5P8K 5P0W 5P0X 5P3C 5P52 5P5A 5P5E 5P6R 5P7C 5P89 5P8A 5P8F 4YD4 4Y4D 3T7X 5P1D 5P41 5P5Q 5P62 5P6P 5P6V 5P6Z 5P7V 5P8G 4Y5M 4Y4A 5P38 5P84 4Y5N 5MB7 5P0P 5P1V 5P2D 5P55 5P5F 5P5W 5P8C 4YD6 4Y4T 4Y4E 3T7Q 5P22 5P4S 5P5R 5P7J 4Y3J 4KUP 5P06 5P0Y 5P1P 5P1S 5P2V 5P4U 4Y50 3T6I 5OZK 5P0O 5P1R 5P4V 5P7M 5P86 5P8J 5DPZ 5P1I 5P3J 5P5C 5P6C 5P6S 4Y3N 5P18 5P1C 5P28 5P2Q 5P4A 5P6M 5P87 4Y3Y 4LP9 3T7P 3Q6Y 5P7W 5HCT 5OZD 5P1J 5P2A 5P36 5P3R 5IS4 4L6B 1OD1 5P11 5P1B 5P2U 3PRS 3PMY 5P3G 5P3H 5P0V 5P13 5P17 5P1A 5P1T 5P2X 5P4E 5P6X 5DR0 4Y3F 4Y41 3WZ6 3PLD 5P15 5P26 5P4F 5P4Y 5P7B 5P37 5P3X 5P4I 5P57 5P5U 4YD7 4Y3T 5P2I 5P75 3PSY 3PMU 5OYV 5P20 5P3N 5P69 5P6D 5P7P 5P8U 4Y5K 4Y4G 5OYY 5OZ0 5P27 5P4H 5P6H 5DR1 4Y4W 4Y5A 3WZ8 5P0U 5P1Z 5P3P 5P6T 5P7T 4Y35 5P3V 5P4K 5P6B 5P7X 5DR8 5DQ5 4Y5G 5OYW 5OZ1 5OZ4 5OZV 5OZX 5P0Q 5P1G 5P29 5P7O 5P7R 5P8O 4Y4Z 4Y3D 4Y43 3PBZ 5OYQ 5OYR 5OYZ 5OZ5 5OZA 5OZB 5OZG 5OZH 5OZJ 5OZM 5OZN 5OZP 5OZY 5P02 5P03 5P0G 5P10 5P2G 5P8N 5DQ1 4Y57 5OZI 5OZQ 5P1U 5P56 5DR4 3PCZ 5P00 5P01 5P0L 5DQ2 5P1N 5P1O 5P1Y 5P2W 5P2Z 5P4J 5P83 5OZF 5OZZ 5P1H 5P2E 5OZW 5OZ6 5P12 5P1K 5P2N 5P8B 4Y3M 4Y3P 2V00 5OZ8 5P2J 5P4P 2JJI 5OJE 5OZO 5P4X 5P5D 5P8V 4Y3W 5OYT 5P1E 5P4Q 4Y36 5P05 5P0K 5P1M 5P81 4Y51 1EPM 1EPN 2ER7 5OZ2 5OZ7 5OZ9 5P08 5P09 5P6K 5P6W 4Y54 5P07 5P2H 4Y53 5P0B 4Y56 5P16 5P2Y 3PI0 5OYS 5OYX 5P7N 5P7Y 5ISJ 5P5G 5P04 4Y4X 3PM4 5P5N 5P78 4Y37 5P2B 5P4T 4YCY 3PBD 5OZC 5P23 5P24 5OZS 5P5L 4LHH 3PLL 5OZL 5OZ3 5P2C 5P3K 4Y4U 5OZR 5OZT 5P0E 5P0H 5P2F 3LZY 3ER5 5ER2 5OG7 5P0A 5P0C 5P2K 5P0D 5P30 3WZ7 3URJ 3PGI 3PB5 1EPP 1EPQ 1ENT 3URL 2VS2 1EPL 1EPO 1EED 3ER3 5ER1 4ER2 4ER1 2ER6 1ER8 1E80 1E81 1E82 1E5O 3URI 1GKT 4ER4 4APE 2ER9 1EPR 2ER0
Thumbnails

AA seq 419 aa AA seqDB search
MSSPLKNALVTAMLAGGALSSPTKQHVGIPVNASPEVGPGKYSFKQVRNPNYKFNGPLSV
KKTYLKYGVPIPAWLEDAVQNSTSGLAERSTGSATTTPIDSLDDAYITPVQIGTPAQTLN
LDFDTGSSDLWVFSSETTASEVDGQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYT
DTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKAS
LDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKS
TSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARI
VIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK
Reference
PMID:1617734
  Authors
Razanamparany V, Jara P, Legoux R, Delmas P, Msayeh F, Kaghad M, Loison G
  Title
Cloning and mutation of the gene encoding endothiapepsin from Cryphonectria parasitica.
  Journal
Curr Genet 21:455-61 (1992)
DOI:10.1007/BF00351655
Reference
PMID:3305016
  Authors
Barkholt V
  Title
Amino acid sequence of endothiapepsin. Complete primary structure of the aspartic protease from Endothia parasitica.
  Journal
Eur J Biochem 167:327-38 (1987)
DOI:10.1111/j.1432-1033.1987.tb13340.x

DBGET integrated database retrieval system