KEGG   Addendum: CAA47898Help
Entry
CAA47898          CDS       T10000                                 

Gene name
TDC
Definition
(KEGG) L-tryptophan decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Taxonomy
TAX:4058
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Organism
ag  Addendum (Catharanthus roseus)
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS
Motif
Other DBs
NCBI-ProteinID: CAA47898
GB: X67662
UniProt: P17770
Structure
PDB: 

AA seq 500 aa AA seqDB search
MGSIDSTNVAMSNSPVGEFKPLEAEEFRKQAHRMVDFIADYYKNVETYPVLSEVEPGYLR
KRIPETAPYLPEPLDDIMKDIQKDIIPGMTNWMSPNFYAFFPATVSSAAFLGEMLSTALN
SVGFTWVSSPAATELEMIVMDWLAQILKLPKSFMFSGTGGGVIQNTTSESILCTIIAARE
RALEKLGPDSIGKLVCYGSDQTHTMFPKTCKLAGIYPNNIRLIPTTVETDFGISPQVLRK
MVEDDVAAGYVPLFLCATLGTTSTTATDPVDSLSEIANEFGIWIHVDAAYAGSACICPEF
RHYLDGIERVDSLSLSPHKWLLAYLDCTCLWVKQPHLLLRALTTNPEYLKNKQSDLDKVV
DFKNWQIATGRKFRSLKLWLILRSYGVVNLQSHIRSDVAMGKMFEEWVRSDSRFEIVVPR
NFSLVCFRLKPDVSSLHVEEVNKKLLDMLNSTGRVYMTHTIVGGIYMLRLAVGSSLTEEH
HVRRVWDLIQKLTDDLLKEA
Reference
  Authors
Ouwerkerk PB, Hallard D, Verpoorte R, Memelink J
  Title
Identification of UV-B light-responsive regions in the promoter of the tryptophan decarboxylase gene from Catharanthus roseus.
  Journal
Plant Mol Biol 41:491-503 (1999)
DOI:10.1023/A:1006321100550

DBGET integrated database retrieval system