KEGG   Addendum: CAA60462
Entry
CAA60462          CDS       T10000                                 

Gene name
rapC
Definition
(KEGG) rapamycin polyketide synthase C
  KO
K16420  rapamycin polyketide synthase A/B/C
Taxonomy
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces rapamycinicus)
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N ADH_zinc_N_2 ADH_zinc_N Docking ACP_syn_III ADH_N
Other DBs
NCBI-ProteinID: CAA60462
GB: X86780
UniProt: Q54299
AA seq 6260 aa
MPEQDKVVEYLRWATAELHTTRAKLEALAAANTEPLAIVGMACRLPGGVSSPEDLWRLVE
SGTDAISDFPADRGWDVENLYDPDPDASGKSYCVQGGFLDSAGGFDASFFGISPREALAM
DPQQRLVLEVSWEAFERAGIEPGSLRGSDTGVFIGAYPGGYGAGAGADLEGYGTTSGPSV
LSGRVSYFFGLEGPAITVDTACSSSLVALHQAGYALRQGECSLALVGGVTVMATPDVFTE
FARQRGLATDGRSKAFADSADGAGFSEGIGVLLVERLSDAEAKGHQVLAVVRSSAVNQDG
ASNGLTAPNGPSQQRVIQTALSNAGLTTAEVDVVEGHGTGTTLGDPIEAQAVIATYGQDR
EQPLLLGSLKSNIGHTQAAAGVSGVIKMVMALRHALVPRTLHVDEPSRHVDWTAGAVELV
TENQPWPEIGRPRRAGVSSFGVSGTNAHVILESAPPTQAEDAAQPVEAPVMGSEPVPLVI
SAKTLPALNAHEDRLRAYLAASPGVDMRAVASTLAMTRSMFEHRGVLLGDGTVSGTAVSD
PRVVFVFPGQGSQRAGMGEELAAAFPVFARIHQQVWDLLDVPDLDVNETGYAQPALFALQ
VALFGLLESWGVRPDAVIGHSVGELAAAYVSGVWSLEDACTLVSARARLMQALPAGGVMV
AVPVSEDEARAVLGEGVEIAAVNGPSSVVLSGDEAAVLQAAEGLGKWTRLATSHAFHSAR
MEPMLEEFRAVAEGLTYRTPQVSMAVGDQVTTAEYWVRQVRDTVRFGEQVASYEDAVFVE
LGADRSLARLVDGVAMLHGDHEAQAAVGALAHLYVNGVSVEWSAVLGDVPVTRVLDLPTY
AFQHQRYWLEGTDRATAGGHPLLGSVVRLAEASGVLFTARVSRSGDLWLRDQTVLPATVF
VEMALAAADEVGCGLVEDLSVEALLLLPDDGAVEVQTWVGEPDEGGRRRLSVHARYGDGE
PWTCLATATLATTTGVAAAAVGWQAGGVWPPAGPVPVGTSAPSLRAVWRLGSDIFTEVAL
DDAHDATRFVRHPGLMTAALTTVGEETPAVWQGLTLHAGNPGELRVRLTSHDDGTLSAEA
TDSTGLPVLTARSLTLRTVPVYEPATSTDDLLTLTWAGIPTPQQTGLTVGAFEDLAADGD
VPVPEVAVFTALPDSDDPLEQTRKLTAQVLHTLQEWLGGERFSDSTLVVRTGTGLAAAGV
SGLMRSAQSEHPGRFVLVESDDALTQDQLAAAVGLDEPRLRVSDGRYEVPRLTRTHAEEP
EPERTWDPDGTVLITGGSGVLAGIAARHLVTERGVRHLLLLSRSAPDEALIGELGELGAR
VETAACDVSDPAALTQVLAGVSPEHPLTAVIHTAGVVDDGVVESLTVQRLETVLRPKADG
AWNLHELTRDADLAAFVMYSSAAGVLGSAGQGNYAAANAFLDALAEQRHAEGLPALAVAW
GLWEDASGLTAQLTDTDRDRIRRGGLRAISAEHGMGLFDSASRHSEPVLVAAPMEPVRDA
EVPALLRSLHRPIARRAAAAGGARWLAALAPAEREKALLKLVSDGAATVLGHADTSTIPA
TTAFKDLGINSLTAVELRNSLAKATELRLPATLVFDYPTPAALAARLDELFTGENPVPVR
GPVSAVAQDEPLAIVGMACRLPGGVSSPEDLWRLLESGTDAVSGFPTDRGWDVENLYDMA
GKSHRAEGGFLDAAAGFDAGFFGISPREALAMDPQQRLVLEVSWEAFERAGIEPGSVRGS
DTGVFMGAYPGGYGIGADLGGFGATASSVSVLSGRVSYFFGLEGPAFTVDTACSSSLVAL
HQAGYALRQGECSLALVGGVTVMATPQTFVEFSRQGGLASDGRCKAFADAADGTGWAEGV
GVLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALSNAGLSTA
EVDVVEAHGTGTTLGDPIEAQALIATYGQDRDQPVLLGSVKSNLGHTQAAAGVSGVIKMV
MALQHGLVPRTLHVDEPSRHVDWSAGAVQLVTENQPWPDMGRARRAGVSSFGISGTNAHV
ILESAPPTQPADNAVIERAPEWVPLVISARTQSALTEHEGRLRAYLAASPGVDMRAVAST
LAMTRSVFEHRAVLLGDDTVTGTAVSDPRAVFVFPGQGSQRAGMGEELAAAFPVFARIHQ
QVWDLLDVPDLEVNETGYAQPALFAMQVALFGLLESWGVRPDAVIGHSVGELAAAYVSGV
WSLEDACTLVSARARLMQALPAGGVMVAVPVSEDEARAVLGEGVEIAAVNGPSSVVLSGD
EAAVLQAAEGLGKWTRLATSHAFHSARMEPMLEEFRAVAEGLTYRTPQVSMAVGDQVTTA
EYWVRQVRDTVRFGEQVASYEDAVFVELGADRSLARLVDGVAMLHGDHEIQAAIGALAHL
YVNGVTVDWPALLGDAPATRVLDLPTYAFQHQRYWLEGTDRATAGGHPLLGSAVRLAEAS
GVLFTARVSRSGDLWLRDQTVLPATVFVEMALAAADEAGCGLVEDLNVEALLLLPDDGAV
QVQTWVSEPDEAGRHRLSIHARYSDSEPWTRLATATLATRGTVSGWQAGEAWPPTGAVPV
ETGVPSLRGVWRRGNEVFAEVALDSTHDATTYALHPALLTAALTTAGEETPAAWQALTLH
ARNPAELRVRLISHDDGTLSVDATDSTGLPVLTVRSLTLRTVPVYEPATSTDDLLTLTWA
EIPAPQETGLTVGRFEDLVSDADVPVPEVAVFTALPDSSENPLEQTRVLTAQVLQAVQTW
LGGERFTDSTLVVRTGTRLAAAGVSGLMRSAQSEHPGRFVLVESDDDTLAPDQLAATVGL
DEPRLRVSGDRYEAPRLARVNASGSEPEAVWDPDGTVLITGGSGVLAGIAARHLVAERGV
RHLLLLSRSAPDEALINQLGELGARVETAACDVSDRAALAQVLAGVSPEHPLTAVIHTAG
VLDDGVVESLTAQRLDTVLRPKADGAWHLHELTRNTDLAAFVMYSSAAGVMGGGGQGNYA
AANAFLDALAEERRAEGLPAIRGGLGLWEDTSGLTTQLTDTDRDRIRRGGLRTITAEYGM
RLFDTASRHGNPILVAAPMDPVWDAEVPALLRSLHRPVARRAASTSDSSARWLAALAPAE
REDALLKLVRDSAALVLGHADASTIPAAAAFKDLGIDSLTAVELRNSLAKATGLRLPNTT
VFDYPTPAILATRLGELFTGENPAPVRPSVSVVGQDEPLAVVGMACRLPGGVSSPEDLWR
LVESGTDAISGFPADRGWDAESLFDPDPDASGKSYCVEGGFLDSAGSFDAGFFGISPREA
LAMDPQQRLIMEVSWEAFERAGIEPGSVRGTHRRLHGRVRGGYGAGADLGGFAATASATS
VLSGRVSYFFGLEGPAITVDTACSSSLVALHQAGYALRQGECSLALVGGVTVMATPQSFV
EFSRQRGLASDGRCKAFADSADGTGWAEGVGVLLVERLSDAQAKGHQVLAVVRSSAVNQD
GASNGLTAPNGPSQQRVIQAALSNAGLAAHEVDVVEAHGTGTTLGDPIEAQALIATYGQD
RERPLLLGSLKSNIGHAQAASGVSGVIKMVMALQHNTVPRTLHVDEPSRHVDWAAGAVEL
VRENQPWPGTDRPRRAGVSSFGVSGTNAHVILESAPPAQPAEEAQPVETPVVASDVLPLV
ISAKTQPALTEHEDRLRAYLAASPGADIRAVASTLAVTRSVFEHRAVLLGDDTVTGTAVT
DPRIVFVFPGQGWQWLGMGSALRDSSVVFAERMAECAAALREFVDWDLFTVLDDPAVVDR
VDVVQPASWAMMVSLAAVWQAAGVRPDAVIGHSQGEIAAACVAGAVSLRDAARIVTLRSQ
AIARGLAGRGAMASVALPAQDVELVDGAWIAAHNGPASTVIAGTPEAVDHVLTAHEAQGV
RVRRITVDYASHTPHVELIRDELLDITSDSSSQTPLVPWLSTVDGTWVDSPLDGEYWYRN
LREPVGFHPAVSQLQAQGDTVFVEVSASPVLLQAMDDDVVTVATLRRDDGDATRMLTALA
QAYVHGVTVDWPAILGTTTTRVLDLPTYAFQHQRYWLKSVDRAAADGHPLLGTVVALPGS
DGVVLTGRVSLATHTWLADHAVRGSVLLPGTAFVELVVRAADEVECDVVDELVIETPLLL
PQTGGVQLSVSVAEADESGHRTVTVFSQADNTDAWIRHVSATISTSDTPLSLPESDTWPP
AQAQPMNVADFYDRLMAEGYEYGPAFQGLQAAWRDGDTVYAEVALAEEQAQEAARYDVHP
ALLDAALHACTLNTPDAEEGVGLPFSWNHVQVHATGPATLRVAVTQEADGWSLRVADDTG
RPVATIGSLITRPVTADTLGSTTDDLLTLTWTVIPPPQETSLPMVRYEDLADGNMPVPDV
VVFTALPNSSENPLGPRPAGPADPLAQPDTDRQVLKPFQTWLPGTFTDSTLVVRTGTGLA
AAAVSGLMRSAQSEHPGRFILVESDDDTLTLRQLAATVGLDEPRLRINDGRYEAARLART
NTTPEDTPLTIPDSRAWLLEQPRSGTLQDLALVPTDTAEQPLRPGEVRIDVRAAGLNFRD
VVVALGMVNDNRPTGGEAAGVVLEVGPDVQDLAPGDRVFGVVGGSFGPAAIADRRMLAVI
PDGWSFTTAASVPVVFATAYYGLVDLAGLSEGESVLIHAAAGGVGMAATQIARHLGARIY
ATASTGKQHILREAGLEDTHIADSRTLSFQETFLNNTHGQGVDVVLNSLSGDFVDASLDL
LPRGGRFVEMGKTDIRDPHQVTADRPGTTYQAFDLMDAGPDRLREIITELLTLFTQGVLL
PLPVQAWDIRQARDAFSWMSRARHIGKIVLTIPRRPDPDGTILITGGSGVLAGILARHLA
AEHGARHLLLLSRTTPDQALIKELAELGAHVDTATCDVSDRAGLARVLAGVSPEHPLTAV
IHTAGALDDGVVESLTTQQLDTVLRPKADGAWHLHELTQNTDLAAFVMYSSAAGVIGGAG
QGNYAAANAFLDALAEQRRAEGLPALALAWGLWDDTSGLTSGLTDTDHDRIRRSGMRTIT
AEHGMRLFDGASRHGEPVLFAAAMSPLRGDVEVPALLRGLQTVKRPQSRTAARNEVGSQP
LSARLTGRTSVEQHRIMLELVLERRSVLGHSSADAIATDTSFKDLGMDSLTAIELRNRLV
AETGLQLPATMVFDYPTANALAAHLLGKLDIPPVQQRLEAPAPSTVTGPADPVADEPSAN
EPIAIVAMACRLPGGVSSPEGLWHLVESGTDAISGFPTDRGWDVEGLFDPDPDAAGKSYC
VQGGFLDTAADFDAPFFGISPREALGMDPQQRLLLETTWEAIERAQIDPKSLRGRDVGVY
VGGAAQGYGVGVDQQHDNGITGSSVSLLSGRVSYALGLEGPGVTVDTACSSSLVALHLAS
QALRQRECSLALVSGVSVMSSPAMFVEFSRQRGLSSDGRCKSFAASADGTIWSEGVGVLV
VERLSDARRLGHRVLATVRGSAVNSDGASNGLTAPNGTSQQRVIRQALANAGLTASDVDV
VEAHGTGTKLGDPIEAEAILATYGQERSAPAWLGSLKSNIGHAMAASGVLSVIKMVEAMA
HGSLPRTLHVDAPSPHVDWTSGSVALLTEHQPWPDDTKLRRAGVSSFGLSGTNAHVVLEQ
YQAPAPPVTPVTPAPPVTPVTPVTPNEPGPLPWVLSAQSPKALREQAGRLYASLAGDSEW
NSLDIGYSLATTRSDFAHRAVAVGSGREDFLRALSKLADGAPWPGLTTATATAKARRVAF
LFDGQGTQRLGMGKELYDSYPAFARAWDTVSAGFDKHLDHSLTDVCFGEGGSTTAGLVDD
TLYAQAGIFAMEAALFGLLEDWGVRPDFVAGHSIGEATAAYASGMLSLENVTTLIVARGR
ALRTTPPGAMVALRAGEEEVREFLSRTGAALDLAAVNSPEAVVVSGEPEPVADFEAAWTA
SGREARKLKVRHAFHSRHVEAVLDEFRTALESLKFRAPALPVVSTVTGRLIDQDEMGTPE
YWLRQVRRPVRFQDAVRELAEQGVGTFVEVGPSGALASAGVECLGGDASFHAVLRPRSPE
DVCLMTAIAELHAGGTAIDWAKVLSGGRAVDLPVYPFQHQSYWLAPAAPDATAVAPVVEE
EGGEYDEPSYADEPRTMLELVHMEVASLLGMADPGVILDDSSFLELGFDSLSAVRLRNRL
SKATGLDLPSTLLFEHPTSAELAAHLDALLDSDIDAAGVYALLEEINELDAEAVDMTAAE
HKAISELLEQLSAKWRTRNE
Reference
PMID:7644502
  Authors
Schwecke T, Aparicio JF, Molnar I, Konig A, Khaw LE, Haydock SF, Oliynyk M, Caffrey P, Cortes J, Lester JB, et al.
  Title
The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin.
  Journal
Proc Natl Acad Sci U S A 92:7839-43 (1995)
DOI:10.1073/pnas.92.17.7839

DBGET integrated database retrieval system