KEGG   Addendum: CAB77207Help
Entry
CAB77207          CDS       T10000                                 

Gene name
pct
Definition
(KEGG) propionate CoA-transferase
  KO
K01026  propionate CoA-transferase [EC:2.8.3.1]
Taxonomy
TAX:28446
  Lineage
Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae; Anaerotignum
Organism
ag  Addendum (Anaerotignum propionicum)
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al AcetylCoA_hydro
Motif
Other DBs
NCBI-ProteinID: CAB77207
GB: AJ276553
UniProt: Q9L3F7
AA seq 524 aa AA seqDB search
MRKVPIITADEAAKLIKDGDTVTTSGFVGNAIPEALDRAVEKRFLETGEPKNITYVYCGS
QGNRDGRGAEHFAHEGLLKRYIAGHWATVPALGKMAMENKMEAYNVSQGALCHLFRDIAS
HKPGVFTKVGIGTFIDPRNGGGKVNDITKEDIVELVEIKGQEYLFYPAFPIHVALIRGTY
ADESGNITFEKEVAPLEGTSVCQAVKNSGGIVVVQVERVVKAGTLDPRHVKVPGIYVDYV
VVADPEDHQQSLDCEYDPALSGEHRRPEVVGEPLPLSAKKVIGRRGAIELEKDVAVNLGV
GAPEYVASVADEEGIVDFMTLTAESGAIGGVPAGGVRFGASYNADALIDQGYQFDYYDGG
GLDLCYLGLAECDEKGNINVSRFGPRIAGCGGFINITQNTPKVFFCGTFTAGGLKVKIED
GKVIIVQEGKQKKFLKAVEQITFNGDVALANKQQVTYITERCVFLLKEDGLHLSEIAPGI
DLQTQILDVMDFAPIIDRDANGQIKLMDAALFAEGLMGLKEMKS
Reference
  Authors
Selmer T, Willanzheimer A, Hetzel M
  Title
Propionate CoA-transferase from Clostridium propionicum. Cloning of gene and identification of glutamate 324 at the active site.
  Journal
Eur J Biochem 269:372-80 (2002)
DOI:10.1046/j.0014-2956.2001.02659.x

DBGET integrated database retrieval system