KEGG   Addendum: CAC37486Help
Entry
CAC37486          CDS       T10000                                 

Gene name
kdhA
Definition
(KEGG) 6-hydroxypseudooxynicotine dehydrogenase subunit alpha (EC:1.5.99.14)
  KO
K19185  6-hydroxypseudooxynicotine dehydrogenase subunit alpha [EC:1.5.99.14]
Taxonomy
TAX:29320
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter
Organism
ag  Addendum (Paenarthrobacter nicotinovorans)
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Motif
Other DBs
NCBI-ProteinID: CAC37486
GB: AJ306903
UniProt: O87681
AA seq 296 aa AA seqDB search
MKPPSFDYVVADSVEHALRLLADGGDDAKIIAGGQSLVPLLNFRMSRPSLLVDINRVPGL
ANIRKSDQTIAIGALTRHAKLTTSKTISQNLPILSEAAAWIAHPQIRNRGTIGGSLAHAD
AAAELPVVLLALDAYVTAQSLQGERKIPLKELLVSHFVSSILPGELIVEVNVPQLPHGSG
AAFDEFSRRHGDYAIGGAASIVTLDEQGKCSRARITVLGGGSTAIRCQEAENILIDSTLS
SHDIAAAAHAAVQGLDPVPTVHGSAQYRAQVIRTMVERTLAKALHRARPTKESMDH
Reference
PMID:9878353
  Authors
Schenk S, Hoelz A, Krauss B, Decker K
  Title
Gene structures and properties of enzymes of the plasmid-encoded nicotine catabolism of Arthrobacter nicotinovorans.
  Journal
J Mol Biol 284:1323-39 (1998)
DOI:10.1006/jmbi.1998.2227

DBGET integrated database retrieval system